Recombinant Human RGS5, His-tagged
| Cat.No. : | RGS5-31322TH |
| Product Overview : | Recombinant full length Human RGS5 (amino acids 1-181) with an N terminal His tag; 205 amino acids with the tag; predicted MWt: 23.5 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 181 amino acids |
| Description : | This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-inducible factor-1 dependent, hypoxia-induced gene which is involved in the induction of endothelial apoptosis. This gene is also one of three genes on chromosome 1q contributing to elevated blood pressure. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Conjugation : | HIS |
| Molecular Weight : | 23.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK |
| Sequence Similarities : | Contains 1 RGS domain. |
| Gene Name | RGS5 regulator of G-protein signaling 5 [ Homo sapiens ] |
| Official Symbol | RGS5 |
| Synonyms | RGS5; regulator of G-protein signaling 5; regulator of G protein signalling 5; |
| Gene ID | 8490 |
| mRNA Refseq | NM_001195303 |
| Protein Refseq | NP_001182232 |
| MIM | 603276 |
| Uniprot ID | O15539 |
| Chromosome Location | 1q23.1 |
| Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; |
| Function | GTPase activator activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| RGS5-3693R | Recombinant Rhesus Macaque RGS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Rgs5-8187M | Recombinant Mouse Rgs5 protein, His & T7-tagged | +Inquiry |
| RGS5-14146M | Recombinant Mouse RGS5 Protein | +Inquiry |
| RGS5-6843H | Recombinant Human RGS5 protein, GST-tagged | +Inquiry |
| RGS5-3876R | Recombinant Rhesus monkey RGS5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RGS5-2371HCL | Recombinant Human RGS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS5 Products
Required fields are marked with *
My Review for All RGS5 Products
Required fields are marked with *
