Recombinant Human RGS5, His-tagged

Cat.No. : RGS5-31322TH
Product Overview : Recombinant full length Human RGS5 (amino acids 1-181) with an N terminal His tag; 205 amino acids with the tag; predicted MWt: 23.5 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 181 amino acids
Description : This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-inducible factor-1 dependent, hypoxia-induced gene which is involved in the induction of endothelial apoptosis. This gene is also one of three genes on chromosome 1q contributing to elevated blood pressure. Alternatively spliced transcript variants encoding different isoforms have been identified.
Conjugation : HIS
Molecular Weight : 23.500kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Sequence Similarities : Contains 1 RGS domain.
Gene Name RGS5 regulator of G-protein signaling 5 [ Homo sapiens ]
Official Symbol RGS5
Synonyms RGS5; regulator of G-protein signaling 5; regulator of G protein signalling 5;
Gene ID 8490
mRNA Refseq NM_001195303
Protein Refseq NP_001182232
MIM 603276
Uniprot ID O15539
Chromosome Location 1q23.1
Pathway Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem;
Function GTPase activator activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RGS5 Products

Required fields are marked with *

My Review for All RGS5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon