Recombinant Human RGS5 protein, GST-tagged

• Cat.No.: RGS5-301392H
• Product Overview: Recombinant Human RGS5 (1-181 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Lys181
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RGS5 regulator of G-protein signaling 5 [ Homo sapiens ]
• Official Symbol: RGS5
• Synonyms: RGS5; regulator of G-protein signaling 5; regulator of G protein signalling 5; MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
• Gene ID: 8490
• mRNA Refseq: NM_001195303
• Protein Refseq: NP_001182232
• MIM: 603276
• UniProt ID: O15539