Recombinant Human RHBDD1 protein, GST-tagged
Cat.No. : | RHBDD1-30183H |
Product Overview : | Recombinant Human RHBDD1 (13-106 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser13-Gln106 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RHBDD1 rhomboid domain containing 1 [ Homo sapiens ] |
Official Symbol | RHBDD1 |
Synonyms | RHBDD1; rhomboid domain containing 1; rhomboid domain-containing protein 1; DKFZp547E052; MGC117258; |
Gene ID | 84236 |
mRNA Refseq | NM_001167608 |
Protein Refseq | NP_001161080 |
UniProt ID | Q8TEB9 |
◆ Recombinant Proteins | ||
Rhbdd1-5502M | Recombinant Mouse Rhbdd1 Protein, Myc/DDK-tagged | +Inquiry |
RHBDD1-7574M | Recombinant Mouse RHBDD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RHBDD1-30183H | Recombinant Human RHBDD1 protein, GST-tagged | +Inquiry |
RHBDD1-5026R | Recombinant Rat RHBDD1 Protein | +Inquiry |
RFL23487MF | Recombinant Full Length Mouse Rhomboid Domain-Containing Protein 1(Rhbdd1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHBDD1-2365HCL | Recombinant Human RHBDD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHBDD1 Products
Required fields are marked with *
My Review for All RHBDD1 Products
Required fields are marked with *