Recombinant Human RHD Protein, His-GST-tagged

Cat.No. : RHD-26H
Product Overview : Recombinant human Rh Blood Group, D Antigen (Ser2~Gly87) with N-terminal His and GST Tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 2-87 a.a.
Description : The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene, which encodes the RhD protein, and a second gene that encodes both the RhC and RhE antigens on a single polypeptide. The two genes, and a third unrelated gene, are found in a cluster on chromosome 1. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Freeze-dried powder
Molecular Mass : 40 kDa
AA Sequence : SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGODLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Purity : > 95%
Applications : Positive Control, Immunogen, SDS-PAGE, WB.
Usage : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Notes : The kit is designed for in vitro and research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Concentration : 200 µg/mL
Storage Buffer : 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose and Proclin300.
Gene Name RHD
Official Symbol RHD Rh blood group D antigen [ Homo sapiens (human) ]
Synonyms RHD; Rh blood group D antigen; RH; Rh4; RH30; RhII; RhPI; DIIIc; RHCED; RHDel; RHPII; RhDCw; CD240D; RHXIII; RHDVA(TT); RhK562-II; blood group Rh(D) polypeptide; D antigen (DCS); RH polypeptide 2; Rh blood group C antigen; Rh blood group CE antigen; Rh blood group CcEe antigen; Rh blood group antigen Evans; Rh blood group, D anitgen; RhD antigen; RhD blood group antigen; RhD polypeptide; Rhesus blood group D antigen allele DIII type 7; Rhesus system D polypeptide; blood group antigen D; blood group protein RHD; rhesus D antigen; truncated Rh blood group D antigen; truncated RhD; truncated rhesus D; truncated rhesus blood group D antigen
Gene ID 6007
mRNA Refseq NM_016124
Protein Refseq NP_057208
MIM 111680
UniProt ID Q02161

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHD Products

Required fields are marked with *

My Review for All RHD Products

Required fields are marked with *

0
cart-icon