Recombinant Human RHOB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RHOB-4495H
Product Overview : RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RHOB (Ras Homolog Family Member B) is a Protein Coding gene. Diseases associated with RHOB include Pancreatic Adenocarcinoma and Cardiomyopathy, Familial Hypertrophic, 1. Among its related pathways are Guidance Cues and Growth Cone Motility and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RHOA.
Molecular Mass : 22.1 kDa
AA Sequence : MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RHOB ras homolog family member B [ Homo sapiens (human) ]
Official Symbol RHOB
Synonyms RHOB; ras homolog family member B; ARH6, ARHB, ras homolog gene family, member B; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; h6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B; ARH6; ARHB; MSTP081;
Gene ID 388
mRNA Refseq NM_004040
Protein Refseq NP_004031
MIM 165370
UniProt ID P62745

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOB Products

Required fields are marked with *

My Review for All RHOB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon