Recombinant Human RHOB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RHOB-4495H |
Product Overview : | RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RHOB (Ras Homolog Family Member B) is a Protein Coding gene. Diseases associated with RHOB include Pancreatic Adenocarcinoma and Cardiomyopathy, Familial Hypertrophic, 1. Among its related pathways are Guidance Cues and Growth Cone Motility and Signaling by GPCR. Gene Ontology (GO) annotations related to this gene include GTP binding and GDP binding. An important paralog of this gene is RHOA. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RHOB ras homolog family member B [ Homo sapiens (human) ] |
Official Symbol | RHOB |
Synonyms | RHOB; ras homolog family member B; ARH6, ARHB, ras homolog gene family, member B; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; h6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B; ARH6; ARHB; MSTP081; |
Gene ID | 388 |
mRNA Refseq | NM_004040 |
Protein Refseq | NP_004031 |
MIM | 165370 |
UniProt ID | P62745 |
◆ Recombinant Proteins | ||
RHOB-3885R | Recombinant Rhesus monkey RHOB Protein, His-tagged | +Inquiry |
RHOB-4695R | Recombinant Rat RHOB Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOB-3529H | Recombinant Human Ras Homolog Gene Family, Member B, His-tagged | +Inquiry |
RHOB-6471C | Recombinant Chicken RHOB | +Inquiry |
RHOB-858C | Recombinant Cynomolgus RHOB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOB-2356HCL | Recombinant Human RHOB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOB Products
Required fields are marked with *
My Review for All RHOB Products
Required fields are marked with *