Recombinant Human RHOC Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RHOC-572H |
| Product Overview : | RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036144) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Molecular Mass : | 22 kDa |
| AA Sequence : | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RHOC ras homolog family member C [ Homo sapiens (human) ] |
| Official Symbol | RHOC |
| Synonyms | RHOC; ras homolog family member C; ARH9, ARHC, ras homolog gene family, member C; rho-related GTP-binding protein RhoC; RhoC; rhoC GTPase; oncogene RHO H9; rho cDNA clone 9; RAS-related homolog 9; small GTP binding protein RhoC; ras homolog gene family, member C; H9; ARH9; ARHC; RHOH9; MGC1448; MGC61427; |
| Gene ID | 389 |
| mRNA Refseq | NM_001042679 |
| Protein Refseq | NP_001036144 |
| MIM | 165380 |
| UniProt ID | P08134 |
| ◆ Recombinant Proteins | ||
| RHOC-1889H | Recombinant Human RHOC Protein, His (Fc)-Avi-tagged | +Inquiry |
| RHOC-30285TH | Recombinant Human RHOC, His-tagged | +Inquiry |
| RHOC-2732H | Active Recombinant Human RHOC protein, His-tagged | +Inquiry |
| RHOC-301274H | Recombinant Full Length Human RHOC protein, GST-tagged | +Inquiry |
| RHOC-7588M | Recombinant Mouse RHOC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RHOC-2351HCL | Recombinant Human RHOC 293 Cell Lysate | +Inquiry |
| RHOC-2352HCL | Recombinant Human RHOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOC Products
Required fields are marked with *
My Review for All RHOC Products
Required fields are marked with *
