Recombinant Human RIC3 protein, His-tagged
Cat.No. : | RIC3-3145H |
Product Overview : | Recombinant Human RIC3 protein(117-369 aa), fused to His tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 117-369 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KLSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSMLRKRNPQGLE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RIC3 resistance to inhibitors of cholinesterase 3 homolog (C. elegans) [ Homo sapiens ] |
Official Symbol | RIC3 |
Synonyms | RIC3; resistance to inhibitors of cholinesterase 3 homolog (C. elegans); protein RIC-3; AYST720; FLJ11608; PRO1385; |
Gene ID | 79608 |
mRNA Refseq | NM_001135109 |
Protein Refseq | NP_001128581 |
MIM | 610509 |
UniProt ID | Q7Z5B4 |
◆ Recombinant Proteins | ||
RIC3-7599M | Recombinant Mouse RIC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RIC3-3892R | Recombinant Rhesus monkey RIC3 Protein, His-tagged | +Inquiry |
RIC3-3709R | Recombinant Rhesus Macaque RIC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RIC3-3145H | Recombinant Human RIC3 protein, His-tagged | +Inquiry |
RIC3-14217M | Recombinant Mouse RIC3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIC3-2341HCL | Recombinant Human RIC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIC3 Products
Required fields are marked with *
My Review for All RIC3 Products
Required fields are marked with *