Recombinant Human RINT1 protein, His-tagged
Cat.No. : | RINT1-2312H |
Product Overview : | Recombinant Human RINT1 protein(630-792 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 630-792 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | WLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNLFPLFSHYCKRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIYKLAQQDVEILLNLRTNWPNTGK |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RINT1 RAD50 interactor 1 [ Homo sapiens ] |
Official Symbol | RINT1 |
Synonyms | RINT1; RAD50 interactor 1; RAD50-interacting protein 1; FLJ11785; RINT 1; hsRINT-1; RINT-1; DKFZp667H2324; |
mRNA Refseq | NM_021930 |
Protein Refseq | NP_068749 |
MIM | 610089 |
UniProt ID | Q6NUQ1 |
Gene ID | 60561 |
◆ Recombinant Proteins | ||
RINT1-2312H | Recombinant Human RINT1 protein, His-tagged | +Inquiry |
RINT1-8464H | Recombinant Human RINT1 protein, GST-tagged | +Inquiry |
RINT1-5375C | Recombinant Chicken RINT1 | +Inquiry |
RINT1-4083Z | Recombinant Zebrafish RINT1 | +Inquiry |
RINT1-14239M | Recombinant Mouse RINT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RINT1-2336HCL | Recombinant Human RINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RINT1 Products
Required fields are marked with *
My Review for All RINT1 Products
Required fields are marked with *