Recombinant Human RINT1 protein, His-tagged
| Cat.No. : | RINT1-2312H |
| Product Overview : | Recombinant Human RINT1 protein(630-792 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 630-792 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | WLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNLFPLFSHYCKRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIYKLAQQDVEILLNLRTNWPNTGK |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RINT1 RAD50 interactor 1 [ Homo sapiens ] |
| Official Symbol | RINT1 |
| Synonyms | RINT1; RAD50 interactor 1; RAD50-interacting protein 1; FLJ11785; RINT 1; hsRINT-1; RINT-1; DKFZp667H2324; |
| mRNA Refseq | NM_021930 |
| Protein Refseq | NP_068749 |
| MIM | 610089 |
| UniProt ID | Q6NUQ1 |
| Gene ID | 60561 |
| ◆ Recombinant Proteins | ||
| RINT1-3440H | Recombinant Human RINT1 protein, His-tagged | +Inquiry |
| RINT1-4083Z | Recombinant Zebrafish RINT1 | +Inquiry |
| RINT1-3899R | Recombinant Rhesus monkey RINT1 Protein, His-tagged | +Inquiry |
| RINT1-3716R | Recombinant Rhesus Macaque RINT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RINT1-5375C | Recombinant Chicken RINT1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RINT1-2336HCL | Recombinant Human RINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RINT1 Products
Required fields are marked with *
My Review for All RINT1 Products
Required fields are marked with *
