Recombinant Human RIPK3

Cat.No. : RIPK3-29985TH
Product Overview : Recombinant fragment corresponding to amino acids 418-518 of Human RIP3 with a propreitary tag at N-terminal; predicted mwt: 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
Molecular Weight : 36.740kDa inclusive of tags
Tissue specificity : Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
Sequence Similarities : Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.Contains 1 protein kinase domain.
Gene Name RIPK3 receptor-interacting serine-threonine kinase 3 [ Homo sapiens ]
Official Symbol RIPK3
Synonyms RIPK3; receptor-interacting serine-threonine kinase 3; receptor-interacting serine/threonine-protein kinase 3; RIP3;
Gene ID 11035
mRNA Refseq NM_006871
Protein Refseq NP_006862
MIM 605817
Uniprot ID Q9Y572
Chromosome Location 14q12
Pathway Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function ATP binding; NF-kappaB-inducing kinase activity; nucleotide binding; protein binding; protein kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RIPK3 Products

Required fields are marked with *

My Review for All RIPK3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon