Recombinant Human RIPK3
| Cat.No. : | RIPK3-29985TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 418-518 of Human RIP3 with a propreitary tag at N-terminal; predicted mwt: 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 101 amino acids |
| Description : | The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Tissue specificity : | Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK |
| Sequence Similarities : | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.Contains 1 protein kinase domain. |
| Gene Name | RIPK3 receptor-interacting serine-threonine kinase 3 [ Homo sapiens ] |
| Official Symbol | RIPK3 |
| Synonyms | RIPK3; receptor-interacting serine-threonine kinase 3; receptor-interacting serine/threonine-protein kinase 3; RIP3; |
| Gene ID | 11035 |
| mRNA Refseq | NM_006871 |
| Protein Refseq | NP_006862 |
| MIM | 605817 |
| Uniprot ID | Q9Y572 |
| Chromosome Location | 14q12 |
| Pathway | Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
| Function | ATP binding; NF-kappaB-inducing kinase activity; nucleotide binding; protein binding; protein kinase activity; |
| ◆ Recombinant Proteins | ||
| RIPK3-4978H | Recombinant Human RIPK3 protein, His-SUMO-tagged | +Inquiry |
| RIPK3-5583H | Recombinant Human RIPK3 Protein (Met1-His132), N-His tagged | +Inquiry |
| RIPK3-5053R | Recombinant Rat RIPK3 Protein | +Inquiry |
| RIPK3-1756H | Recombinant Full Length Human RIPK3 Protein (1-518 aa), His-tagged | +Inquiry |
| RIPK3-2348H | Recombinant Full Length Human RIPK3 protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RIPK3-2332HCL | Recombinant Human RIPK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIPK3 Products
Required fields are marked with *
My Review for All RIPK3 Products
Required fields are marked with *
