Recombinant Human RMI2 Protein, GST-tagged

• Cat.No.: RMI2-130H
• Product Overview: Recombinant Human RMI2 Protein(99-147 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 99-147 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AASequence: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: RMI2 RMI2, RecQ mediated genome instability 2, homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RMI2
• Synonyms: BLAP18; C16orf75
• Gene ID: 116028
• mRNA Refseq: NM_152308.1
• Protein Refseq: NP_689521.1
• MIM: 612426
• UniProt ID: Q96E14