Recombinant Human RNASE6, His-tagged
Cat.No. : | RNASE6-184H |
Product Overview : | Recombinant Human Ribonuclease K6/RNASE6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Trp24-Leu150) of Human RNASE6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 24-150 a.a. |
Description : | Ribonuclease K6 (RNASE6) is a secreted protein that belongs to the pancreatic ribonuclease family. Human RNASE6 is synthesized as a 150 amino acid precursor that contains a 23 amino acid signal sequence, and a 127 amino acid mature chain. RNASE6 is expressed in many tissues, with high expression levels in the lung, with lower expression levels in the heart, placenta, kidney, pancreas, liver, brain, and skeletal muscle. It is also detected in monocytes and neutrophils. RNASE6 may have a role in host defense. |
AA Sequence : | WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNR RHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSILVDH HHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
RNASE6-184H | Recombinant Human RNASE6, His-tagged | +Inquiry |
RNASE6-3911R | Recombinant Rhesus monkey RNASE6 Protein, His-tagged | +Inquiry |
RNASE6-5644H | Recombinant Human RNASE6 protein, His&Myc-tagged | +Inquiry |
RNASE6-7923H | Recombinant Human RNASE6 protein, His-tagged | +Inquiry |
RNASE6-3546H | Recombinant Human RNASE6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE6 Products
Required fields are marked with *
My Review for All RNASE6 Products
Required fields are marked with *
0
Inquiry Basket