Recombinant Human RNASE7 protein, hFc-tagged

• Cat.No.: RNASE7-8643H
• Product Overview: Recombinant Human RNASE7 protein(Q9H1E1)(29-156aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 29-156aa
• Tag: C-hFc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

Gene Information

• Gene Name: RNASE7 ribonuclease, RNase A family, 7 [ Homo sapiens ]
• Official Symbol: RNASE7
• Synonyms: RNASE7; ribonuclease, RNase A family, 7; ribonuclease 7; SAP-2; RNase 7; skin-derived antimicrobial protein 2; MGC133220
• Gene ID: 84659
• mRNA Refseq: NM_032572
• Protein Refseq: NP_115961
• MIM: 612484
• UniProt ID: Q9H1E1