Recombinant Human RNASE7 protein, hFc-tagged
Cat.No. : | RNASE7-8643H |
Product Overview : | Recombinant Human RNASE7 protein(Q9H1E1)(29-156aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 29-156aa |
Tag : | C-hFc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL |
Gene Name | RNASE7 ribonuclease, RNase A family, 7 [ Homo sapiens ] |
Official Symbol | RNASE7 |
Synonyms | RNASE7; ribonuclease, RNase A family, 7; ribonuclease 7; SAP-2; RNase 7; skin-derived antimicrobial protein 2; MGC133220; |
Gene ID | 84659 |
mRNA Refseq | NM_032572 |
Protein Refseq | NP_115961 |
MIM | 612484 |
UniProt ID | Q9H1E1 |
◆ Recombinant Proteins | ||
RNASE7-29H | Recombinant Human RNASE7 protein, GST-tagged | +Inquiry |
RNASE7-548H | Recombinant Human ribonuclease, RNase A family, 7, His-tagged | +Inquiry |
RNASE7-8643H | Recombinant Human RNASE7 protein, hFc-tagged | +Inquiry |
RNASE7-6634H | Recombinant Human RNASE7 Protein (Lys31-Val155), N-His tagged | +Inquiry |
RNASE7-645HF | Recombinant Full Length Human RNASE7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASE7-2317HCL | Recombinant Human RNASE7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASE7 Products
Required fields are marked with *
My Review for All RNASE7 Products
Required fields are marked with *