Recombinant Human RNASEK Full Length Transmembrane protein, His-tagged
| Cat.No. : | RNASEK-2951H |
| Product Overview : | Recombinant Human RNASEK protein(Q6P5S7)(1-137aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-137aa |
| Form : | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| AA Sequence : | MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | RNASEK ribonuclease, RNase K [ Homo sapiens ] |
| Official Symbol | RNASEK |
| Synonyms | RNASEK; ribonuclease, RNase K; ribonuclease kappa; MGC71993; RNase kappa; MGC48891; |
| Gene ID | 440400 |
| mRNA Refseq | NM_001004333 |
| Protein Refseq | NP_001004333 |
| UniProt ID | Q6P5S7 |
| ◆ Recombinant Proteins | ||
| RNASEK-3732R | Recombinant Rhesus Macaque RNASEK Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNASEK-14275M | Recombinant Mouse RNASEK Protein | +Inquiry |
| RFL35543HF | Recombinant Full Length Human Ribonuclease Kappa(Rnasek) Protein, His-Tagged | +Inquiry |
| RNASEK-3915R | Recombinant Rhesus monkey RNASEK Protein, His-tagged | +Inquiry |
| RNASEK-2951H | Recombinant Human RNASEK Full Length Transmembrane protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNASEK-2315HCL | Recombinant Human RNASEK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNASEK Products
Required fields are marked with *
My Review for All RNASEK Products
Required fields are marked with *
