Recombinant Human RNASEK Full Length Transmembrane protein, His-tagged

Cat.No. : RNASEK-2951H
Product Overview : Recombinant Human RNASEK protein(Q6P5S7)(1-137aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-137aa
Form : Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence : MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name RNASEK ribonuclease, RNase K [ Homo sapiens ]
Official Symbol RNASEK
Synonyms RNASEK; ribonuclease, RNase K; ribonuclease kappa; MGC71993; RNase kappa; MGC48891;
Gene ID 440400
mRNA Refseq NM_001004333
Protein Refseq NP_001004333
UniProt ID Q6P5S7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNASEK Products

Required fields are marked with *

My Review for All RNASEK Products

Required fields are marked with *

0
cart-icon
0
compare icon