Recombinant Human RNASEK Full Length Transmembrane protein, His-tagged

• Cat.No.: RNASEK-2951H
• Product Overview: Recombinant Human RNASEK protein(Q6P5S7)(1-137aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-137aa
• Form: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• AA Sequence: MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: RNASEK ribonuclease, RNase K [ Homo sapiens ]
• Official Symbol: RNASEK
• Synonyms: RNASEK; ribonuclease, RNase K; ribonuclease kappa; MGC71993; RNase kappa; MGC48891
• Gene ID: 440400
• mRNA Refseq: NM_001004333
• Protein Refseq: NP_001004333
• UniProt ID: Q6P5S7