Recombinant Human RNASET2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RNASET2-5129H
Product Overview : RNASET2 MS Standard C13 and N15-labeled recombinant protein (NP_003721) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
Molecular Mass : 29.5 kDa
AA Sequence : MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RNASET2 ribonuclease T2 [ Homo sapiens (human) ]
Official Symbol RNASET2
Synonyms RNASET2; ribonuclease T2; bA514O12.3; FLJ10907; RNASE6PL; ribonuclease 6; FLJ42372; RP11-514O12.3;
Gene ID 8635
mRNA Refseq NM_003730
Protein Refseq NP_003721
MIM 612944
UniProt ID O00584

Not For Human Consumption!

Inquiry

  • Reviews (1)
  • Q&As (0)

Customer Reviews

Write a review
Reviews
01/25/2025

RNase T2 works very well.

Ask a Question for All RNASET2 Products

Required fields are marked with *

My Review for All RNASET2 Products

Required fields are marked with *

0
cart-icon