Recombinant Human RNASET2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNASET2-5129H |
Product Overview : | RNASET2 MS Standard C13 and N15-labeled recombinant protein (NP_003721) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNASET2 ribonuclease T2 [ Homo sapiens (human) ] |
Official Symbol | RNASET2 |
Synonyms | RNASET2; ribonuclease T2; bA514O12.3; FLJ10907; RNASE6PL; ribonuclease 6; FLJ42372; RP11-514O12.3; |
Gene ID | 8635 |
mRNA Refseq | NM_003730 |
Protein Refseq | NP_003721 |
MIM | 612944 |
UniProt ID | O00584 |
◆ Recombinant Proteins | ||
Rnaset2-2022R | Recombinant Rat Rnaset2 Protein, His-tagged | +Inquiry |
RNASET2-408HFL | Recombinant Full Length Human RNASET2 Protein, C-Flag-tagged | +Inquiry |
RNASET2-551H | Recombinant Human RNASET2 Protein, His-tagged | +Inquiry |
RNASET2-3734R | Recombinant Rhesus Macaque RNASET2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNASET2-763H | Recombinant Human RNASET2 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNASET2-448HCL | Recombinant Human RNASET2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Ask a Question for All RNASET2 Products
Required fields are marked with *
My Review for All RNASET2 Products
Required fields are marked with *