Recombinant Human RND1 protein, GST-tagged
Cat.No. : | RND1-2330H |
Product Overview : | Recombinant Human RND1 protein(1-232 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-232 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RND1 Rho family GTPase 1 [ Homo sapiens ] |
Official Symbol | RND1 |
Synonyms | RND1; Rho family GTPase 1; rho-related GTP-binding protein Rho6; ARHS; ras homolog gene family; member S; Rho6; RHOS; GTP-binding protein; ras homolog gene family, member S; RHO6; FLJ42294; |
mRNA Refseq | NM_014470 |
Protein Refseq | NP_055285 |
MIM | 609038 |
UniProt ID | Q92730 |
Gene ID | 27289 |
◆ Recombinant Proteins | ||
RND1-7638M | Recombinant Mouse RND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RND1-14279M | Recombinant Mouse RND1 Protein | +Inquiry |
RND1-3600H | Recombinant Human RND1, His-tagged | +Inquiry |
RND1-2683H | Recombinant Human RND1 protein, His-tagged | +Inquiry |
RND1-701H | Recombinant Human RND1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RND1-2314HCL | Recombinant Human RND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RND1 Products
Required fields are marked with *
My Review for All RND1 Products
Required fields are marked with *