Recombinant Human RNF11 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNF11-5202H |
Product Overview : | RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). |
Molecular Mass : | 17.4 kDa |
AA Sequence : | MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNF11 ring finger protein 11 [ Homo sapiens (human) ] |
Official Symbol | RNF11 |
Synonyms | RNF11; ring finger protein 11; RING finger protein 11; CGI 123; MGC51169; Sid1669p; CGI-123; SID1669; |
Gene ID | 26994 |
mRNA Refseq | NM_014372 |
Protein Refseq | NP_055187 |
MIM | 612598 |
UniProt ID | Q9Y3C5 |
◆ Recombinant Proteins | ||
RNF11-2332H | Recombinant Human RNF11, GST-tagged | +Inquiry |
RNF11-2753H | Recombinant Human RNF11 Protein (2-154 aa), His-tagged | +Inquiry |
RNF11-5202H | Recombinant Human RNF11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rnf11-5541M | Recombinant Mouse Rnf11 Protein, Myc/DDK-tagged | +Inquiry |
RNF11-0460H | Recombinant Human RNF11 Protein (G2-N154), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF11-2310HCL | Recombinant Human RNF11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF11 Products
Required fields are marked with *
My Review for All RNF11 Products
Required fields are marked with *