Recombinant Human RNF11 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RNF11-5202H
Product Overview : RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN).
Molecular Mass : 17.4 kDa
AA Sequence : MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RNF11 ring finger protein 11 [ Homo sapiens (human) ]
Official Symbol RNF11
Synonyms RNF11; ring finger protein 11; RING finger protein 11; CGI 123; MGC51169; Sid1669p; CGI-123; SID1669;
Gene ID 26994
mRNA Refseq NM_014372
Protein Refseq NP_055187
MIM 612598
UniProt ID Q9Y3C5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF11 Products

Required fields are marked with *

My Review for All RNF11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon