Recombinant Human RNF114, His-tagged
Cat.No. : | RNF114-31567TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-228 of Human ZNF313 with N terminal His tag, 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-228 a.a. |
Conjugation : | HIS |
Tissue specificity : | Expressed in numerous tissues, including skin, CD4 lymphocytes and dendritic cells. Highest levels in testis. |
Form : | Lyophilised:Reconstitute with 140 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPV QVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAV ELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGL VEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREH IQRRHRFSYDTFVDYDVDEEDMMNQVLQRSIIDQ |
Sequence Similarities : | Contains 1 RING-type zinc finger. |
Full Length : | Full L. |
Gene Name | RNF114 ring finger protein 114 [ Homo sapiens ] |
Official Symbol | RNF114 |
Synonyms | RNF114; ring finger protein 114; zinc finger protein 313 , ZNF313; RING finger protein 114; PSORS12; |
Gene ID | 55905 |
mRNA Refseq | NM_018683 |
Protein Refseq | NP_061153 |
MIM | 612451 |
Uniprot ID | Q9Y508 |
Chromosome Location | 20q13 |
Function | metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
RNF114-504H | Recombinant Human ring finger protein 114, His-tagged | +Inquiry |
RNF114-5105H | Recombinant Human RNF114, His-tagged | +Inquiry |
Rnf114-5544M | Recombinant Mouse Rnf114 Protein, Myc/DDK-tagged | +Inquiry |
RNF114-4727R | Recombinant Rat RNF114 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF114-176HFL | Recombinant Full Length Human RNF114 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF114-2306HCL | Recombinant Human RNF114 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF114 Products
Required fields are marked with *
My Review for All RNF114 Products
Required fields are marked with *
0
Inquiry Basket