Recombinant Human RNF114, His-tagged
| Cat.No. : | RNF114-31567TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-228 of Human ZNF313 with N terminal His tag, 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-228 a.a. |
| Conjugation : | HIS |
| Tissue specificity : | Expressed in numerous tissues, including skin, CD4 lymphocytes and dendritic cells. Highest levels in testis. |
| Form : | Lyophilised:Reconstitute with 140 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPV QVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAV ELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYTFPCPYCPEKNFDQEGL VEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREH IQRRHRFSYDTFVDYDVDEEDMMNQVLQRSIIDQ |
| Sequence Similarities : | Contains 1 RING-type zinc finger. |
| Full Length : | Full L. |
| Gene Name | RNF114 ring finger protein 114 [ Homo sapiens ] |
| Official Symbol | RNF114 |
| Synonyms | RNF114; ring finger protein 114; zinc finger protein 313 , ZNF313; RING finger protein 114; PSORS12; |
| Gene ID | 55905 |
| mRNA Refseq | NM_018683 |
| Protein Refseq | NP_061153 |
| MIM | 612451 |
| Uniprot ID | Q9Y508 |
| Chromosome Location | 20q13 |
| Function | metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| RNF114-176HFL | Recombinant Full Length Human RNF114 Protein, C-Flag-tagged | +Inquiry |
| RNF114-31567TH | Recombinant Human RNF114, His-tagged | +Inquiry |
| RNF114-1897H | Recombinant Human RNF114 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNF114-2334H | Recombinant Human RNF114, GST-tagged | +Inquiry |
| RNF114-5105H | Recombinant Human RNF114, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF114-2306HCL | Recombinant Human RNF114 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF114 Products
Required fields are marked with *
My Review for All RNF114 Products
Required fields are marked with *
