Recombinant Human RNF123 protein, GST-tagged
Cat.No. : | RNF123-157H |
Product Overview : | Recombinant Human RNF123(1216 a.a. - 1314 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1216-1314 a.a. |
Description : | The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFF CKTTIVSVEDWEKGANTSTTSSAA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | RNF123 ring finger protein 123 [ Homo sapiens ] |
Official Symbol | RNF123 |
Synonyms | RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222; |
Gene ID | 63891 |
mRNA Refseq | NM_022064 |
Protein Refseq | NP_071347 |
MIM | 614472 |
UniProt ID | Q5XPI4 |
Chromosome Location | 3p24.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | ligase activity; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
RNF123-7646M | Recombinant Mouse RNF123 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF123-5585C | Recombinant Chicken RNF123 | +Inquiry |
RNF123-14293M | Recombinant Mouse RNF123 Protein | +Inquiry |
RNF123-156H | Recombinant Human RNF123 protein, His-tagged | +Inquiry |
RNF123-157H | Recombinant Human RNF123 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF123 Products
Required fields are marked with *
My Review for All RNF123 Products
Required fields are marked with *