Recombinant Human RNF123 protein, GST-tagged

• Cat.No.: RNF123-157H
• Product Overview: Recombinant Human RNF123(1216 a.a. - 1314 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1216-1314 a.a.
• Description: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFF CKTTIVSVEDWEKGANTSTTSSAA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RNF123 ring finger protein 123 [ Homo sapiens ]
• Official Symbol: RNF123
• Synonyms: RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222
• Gene ID: 63891
• mRNA Refseq: NM_022064
• Protein Refseq: NP_071347
• MIM: 614472
• UniProt ID: Q5XPI4
• Chromosome Location: 3p24.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: ligase activity; metal ion binding; zinc ion binding