Recombinant Human RNF123 protein, GST-tagged RNF123-157H

Recombinant Human RNF123 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human RNF123 protein, GST-tagged

Recombinant Human RNF123 protein, GST-tagged

RNF123 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : RNF123-157H
Product Overview : Recombinant Human RNF123(1216 a.a. - 1314 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFF CKTTIVSVEDWEKGANTSTTSSAA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : RNF123 ring finger protein 123 [ Homo sapiens ]
Official Symbol : RNF123
Synonyms : RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222;
Gene ID : 63891
mRNA Refseq : NM_022064
Protein Refseq : NP_071347
MIM : 614472
UniProt ID : Q5XPI4
Chromosome Location : 3p24.3
Pathway : Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : ligase activity; metal ion binding; zinc ion binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy