"RNF123" Related Products

Recombinant Human RNF123 protein, GST-tagged

Cat.No.: RNF123-157H
Product Overview: Recombinant Human RNF123(1216 a.a. - 1314 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFF CKTTIVSVEDWEKGANTSTTSSAA
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: RNF123 ring finger protein 123 [ Homo sapiens ]
Official Symbol: RNF123
Synonyms: RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222;
Gene ID: 63891
mRNA Refseq: NM_022064
Protein Refseq: NP_071347
MIM: 614472
UniProt ID: Q5XPI4
Chromosome Location: 3p24.3
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: ligase activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.