Recombinant Human RNF130 Protein, GST tagged
| Cat.No. : | RNF130-15H |
| Product Overview : | Human RNF130 partial ORF ( NP_060904, 28 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal was experessed in Wheat germ cell free in vitro. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat germ cell free in vitro |
| Tag : | GST |
| Protein Length : | 28-127 aa |
| Description : | The protein encoded by this gene contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells. |
| AASequence : | DNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNA |
| Molecular Mass : | 36.74 kDa |
| Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Application : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Note : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RNF130 ring finger protein 130 [ Homo sapiens (human) ] |
| Official Symbol | RNF130 |
| Synonyms | RNF130; ring finger protein 130; E3 ubiquitin-protein ligase RNF130; G1RZFP; GOLIATH; GP; H-Goliath; goliath homolog; g1-related zinc finger protein; MGC99542; MGC117241; MGC138647; |
| Gene ID | 55819 |
| mRNA Refseq | NM_018434 |
| Protein Refseq | NP_060904 |
| MIM | 619163 |
| UniProt ID | Q86XS8 |
| ◆ Recombinant Proteins | ||
| RNF130-14298M | Recombinant Mouse RNF130 Protein | +Inquiry |
| RNF130-10H | Recombinant Full Length Human RNF130 Protein, GST tagged | +Inquiry |
| RNF130-7649M | Recombinant Mouse RNF130 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RNF130-15H | Recombinant Human RNF130 Protein, GST tagged | +Inquiry |
| RNF130-30H | Recombinant Human RNF130 protein, MBP & His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF130-2299HCL | Recombinant Human RNF130 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF130 Products
Required fields are marked with *
My Review for All RNF130 Products
Required fields are marked with *
