Recombinant Human RNF130 protein, MBP & His-tagged
| Cat.No. : | RNF130-30H |
| Product Overview : | Recombinant Human RNF130 protein(Q86XS8)(Ser31-Phe190), fused with N-terminal MBP tag and & C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 31-190 aa |
| Form : | Phosphate buffered saline |
| AASequence : | SQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNF |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | RNF130 ring finger protein 130 [ Homo sapiens ] |
| Official Symbol | RNF130 |
| Synonyms | RNF130; ring finger protein 130; E3 ubiquitin-protein ligase RNF130; G1RZFP; GOLIATH; GP; H-Goliath; goliath homolog; g1-related zinc finger protein; MGC99542; MGC117241; MGC138647; |
| Gene ID | 55819 |
| mRNA Refseq | NM_018434 |
| Protein Refseq | NP_060904 |
| UniProt ID | Q86XS8 |
| ◆ Recombinant Proteins | ||
| RNF130-10H | Recombinant Full Length Human RNF130 Protein, GST tagged | +Inquiry |
| RNF130-31331TH | Recombinant Human RNF130, His-tagged | +Inquiry |
| RNF130-14298M | Recombinant Mouse RNF130 Protein | +Inquiry |
| RNF130-15H | Recombinant Human RNF130 Protein, GST tagged | +Inquiry |
| RNF130-7649M | Recombinant Mouse RNF130 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNF130-2299HCL | Recombinant Human RNF130 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF130 Products
Required fields are marked with *
My Review for All RNF130 Products
Required fields are marked with *
