Recombinant Human RNF130 protein, MBP & His-tagged

Cat.No. : RNF130-30H
Product Overview : Recombinant Human RNF130 protein(Q86XS8)(Ser31-Phe190), fused with N-terminal MBP tag and & C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&MBP
Protein Length : 31-190 aa
Form : Phosphate buffered saline
AASequence : SQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNF
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name RNF130 ring finger protein 130 [ Homo sapiens ]
Official Symbol RNF130
Synonyms RNF130; ring finger protein 130; E3 ubiquitin-protein ligase RNF130; G1RZFP; GOLIATH; GP; H-Goliath; goliath homolog; g1-related zinc finger protein; MGC99542; MGC117241; MGC138647;
Gene ID 55819
mRNA Refseq NM_018434
Protein Refseq NP_060904
UniProt ID Q86XS8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF130 Products

Required fields are marked with *

My Review for All RNF130 Products

Required fields are marked with *

0
cart-icon