Recombinant Human RNF130 protein, MBP & His-tagged

• Cat.No.: RNF130-30H
• Product Overview: Recombinant Human RNF130 protein(Q86XS8)(Ser31-Phe190), fused with N-terminal MBP tag and & C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 31-190 aa
• Form: Phosphate buffered saline
• AASequence: SQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNF
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RNF130 ring finger protein 130 [ Homo sapiens ]
• Official Symbol: RNF130
• Synonyms: RNF130; ring finger protein 130; E3 ubiquitin-protein ligase RNF130; G1RZFP; GOLIATH; GP; H-Goliath; goliath homolog; g1-related zinc finger protein; MGC99542; MGC117241; MGC138647
• Gene ID: 55819
• mRNA Refseq: NM_018434
• Protein Refseq: NP_060904
• UniProt ID: Q86XS8