Recombinant Human RNF14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNF14-5464H
• Product Overview: RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.
• Molecular Mass: 53.8 kDa
• AA Sequence: Tags(s)XCRQKIEKLRRMNCWPWQVFTMEMNLEKQSLSKVEKPGSIWICHRISRYL*AAIQMSVSRIVALNTPFAFCLHLC*TLNCHQIIHPLPHLHSHLVANGCHQLSYLLYAST*TTYGKNTVAAWSCLPGCNFLRKRP*HT*ILSLLLSSRLVLRKKCREGQLKLLPTQS*ILEELLDLM*TKRKLWMREQCRMWNHCQI*SRKSWTLIKLSR*NALIVNCSCAVSVSVRSWVVNACTSWSAGMCTAKPV*RTTLKSRSEMARFNASTAQNQSALRWPLLVRSKS*WKQSYLPVMTAFSSSPPWT*WQMWCTAPGRAASCL*CRNLAAPWVSAPAAILPSVLCAG*PTMGSPHVR*LQRN*WTYEMNTCKRMRLIKDFWIKGMVRE*FRRHWKRWKVRSG*RRTQRAAHVVELP*RN*TDVTR*HVLAVCNISVGFAWVLSLEQTLTNISMTLVHHVLTGCFMLWMLTTIFGKMR*KTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNF14 ring finger protein 14 [ Homo sapiens (human) ]
• Official Symbol: RNF14
• Synonyms: RNF14; ring finger protein 14; E3 ubiquitin-protein ligase RNF14; ARA54; HFB30; TRIAD2; androgen receptor associated protein 54; androgen receptor-associated protein 54; HRIHFB2038; FLJ26004
• Gene ID: 9604
• mRNA Refseq: NM_183399
• Protein Refseq: NP_899646
• MIM: 605675
• UniProt ID: Q9UBS8