Recombinant Human RNF14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNF14-5464H |
Product Overview : | RNF14 MS Standard C13 and N15-labeled recombinant protein (NP_899646) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | Tags(s)XCRQKIEKLRRMNCWPWQVFTMEMNLEKQSLSKVEKPGSIWICHRISRYL*AAIQMSVSRIVALNTPFAFCLHLC*TLNCHQIIHPLPHLHSHLVANGCHQLSYLLYAST*TTYGKNTVAAWSCLPGCNFLRKRP*HT*ILSLLLSSRLVLRKKCREGQLKLLPTQS*ILEELLDLM*TKRKLWMREQCRMWNHCQI*SRKSWTLIKLSR*NALIVNCSCAVSVSVRSWVVNACTSWSAGMCTAKPV*RTTLKSRSEMARFNASTAQNQSALRWPLLVRSKS*WKQSYLPVMTAFSSSPPWT*WQMWCTAPGRAASCL*CRNLAAPWVSAPAAILPSVLCAG*PTMGSPHVR*LQRN*WTYEMNTCKRMRLIKDFWIKGMVRE*FRRHWKRWKVRSG*RRTQRAAHVVELP*RN*TDVTR*HVLAVCNISVGFAWVLSLEQTLTNISMTLVHHVLTGCFMLWMLTTIFGKMR*KTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNF14 ring finger protein 14 [ Homo sapiens (human) ] |
Official Symbol | RNF14 |
Synonyms | RNF14; ring finger protein 14; E3 ubiquitin-protein ligase RNF14; ARA54; HFB30; TRIAD2; androgen receptor associated protein 54; androgen receptor-associated protein 54; HRIHFB2038; FLJ26004; |
Gene ID | 9604 |
mRNA Refseq | NM_183399 |
Protein Refseq | NP_899646 |
MIM | 605675 |
UniProt ID | Q9UBS8 |
◆ Recombinant Proteins | ||
RNF14-0685H | Recombinant Human RNF14 Protein (S2-D474), Tag Free | +Inquiry |
RNF14-5464H | Recombinant Human RNF14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF14-0686H | Recombinant Human RNF14 Protein (S2-D474), His tagged | +Inquiry |
RNF14-2948H | Recombinant Human RNF14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF14-3747R | Recombinant Rhesus Macaque RNF14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF14-2296HCL | Recombinant Human RNF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF14 Products
Required fields are marked with *
My Review for All RNF14 Products
Required fields are marked with *
0
Inquiry Basket