Recombinant Human RNF181 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNF181-4615H |
Product Overview : | RNF181 MS Standard C13 and N15-labeled recombinant protein (NP_057578) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RNF181 binds the integrin alpha-IIb (ITGA2B)/beta-3 (ITGB3) complex and has E3 ubiquitin ligase activity. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNF181 ring finger protein 181 [ Homo sapiens (human) ] |
Official Symbol | RNF181 |
Synonyms | RNF181; ring finger protein 181; E3 ubiquitin-protein ligase RNF181; HSPC238; |
Gene ID | 51255 |
mRNA Refseq | NM_016494 |
Protein Refseq | NP_057578 |
MIM | 612490 |
UniProt ID | Q9P0P0 |
◆ Recombinant Proteins | ||
RNF181-4736R | Recombinant Rat RNF181 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF181-7149H | Recombinant Human Ring Finger Protein 181, His-tagged | +Inquiry |
RNF181-14323M | Recombinant Mouse RNF181 Protein | +Inquiry |
RNF181-4615H | Recombinant Human RNF181 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RNF181-3936R | Recombinant Rhesus monkey RNF181 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF181-1522HCL | Recombinant Human RNF181 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF181 Products
Required fields are marked with *
My Review for All RNF181 Products
Required fields are marked with *
0
Inquiry Basket