Recombinant Human RNF181 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNF181-4615H
• Product Overview: RNF181 MS Standard C13 and N15-labeled recombinant protein (NP_057578) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RNF181 binds the integrin alpha-IIb (ITGA2B)/beta-3 (ITGB3) complex and has E3 ubiquitin ligase activity.
• Molecular Mass: 17.9 kDa
• AA Sequence: MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNF181 ring finger protein 181 [ Homo sapiens (human) ]
• Official Symbol: RNF181
• Synonyms: RNF181; ring finger protein 181; E3 ubiquitin-protein ligase RNF181; HSPC238
• Gene ID: 51255
• mRNA Refseq: NM_016494
• Protein Refseq: NP_057578
• MIM: 612490
• UniProt ID: Q9P0P0