Recombinant Human RNF181 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RNF181-4615H
Product Overview : RNF181 MS Standard C13 and N15-labeled recombinant protein (NP_057578) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RNF181 binds the integrin alpha-IIb (ITGA2B)/beta-3 (ITGB3) complex and has E3 ubiquitin ligase activity.
Molecular Mass : 17.9 kDa
AA Sequence : MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RNF181 ring finger protein 181 [ Homo sapiens (human) ]
Official Symbol RNF181
Synonyms RNF181; ring finger protein 181; E3 ubiquitin-protein ligase RNF181; HSPC238;
Gene ID 51255
mRNA Refseq NM_016494
Protein Refseq NP_057578
MIM 612490
UniProt ID Q9P0P0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF181 Products

Required fields are marked with *

My Review for All RNF181 Products

Required fields are marked with *

0
cart-icon
0
compare icon