Recombinant Human RNF185 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNF185-5855H
• Product Overview: RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RNF185 (Ring Finger Protein 185) is a Protein Coding gene. Diseases associated with RNF185 include Cystic Fibrosis and Uremic Neuropathy. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Calnexin/calreticulin cycle. Gene Ontology (GO) annotations related to this gene include ligase activity. An important paralog of this gene is RNF5.
• Molecular Mass: 14 kDa
• AA Sequence: MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNF185 ring finger protein 185 [ Homo sapiens (human) ]
• Official Symbol: RNF185
• Synonyms: RNF185; ring finger protein 185; E3 ubiquitin-protein ligase RNF185; FLJ38628; hypothetical protein FLJ38628; BSK65-MONO1; BSK65-MONO2; BSK65-PANC1; BSK65-PANC2; BSK65-TEST1; BSK65-TEST2; BSK65-TEST3
• Gene ID: 91445
• mRNA Refseq: NM_001135825
• Protein Refseq: NP_001129297
• UniProt ID: Q96GF1