Recombinant Human RNF185 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RNF185-5855H
Product Overview : RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RNF185 (Ring Finger Protein 185) is a Protein Coding gene. Diseases associated with RNF185 include Cystic Fibrosis and Uremic Neuropathy. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Calnexin/calreticulin cycle. Gene Ontology (GO) annotations related to this gene include ligase activity. An important paralog of this gene is RNF5.
Molecular Mass : 14 kDa
AA Sequence : MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RNF185 ring finger protein 185 [ Homo sapiens (human) ]
Official Symbol RNF185
Synonyms RNF185; ring finger protein 185; E3 ubiquitin-protein ligase RNF185; FLJ38628; hypothetical protein FLJ38628; BSK65-MONO1; BSK65-MONO2; BSK65-PANC1; BSK65-PANC2; BSK65-TEST1; BSK65-TEST2; BSK65-TEST3;
Gene ID 91445
mRNA Refseq NM_001135825
Protein Refseq NP_001129297
UniProt ID Q96GF1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF185 Products

Required fields are marked with *

My Review for All RNF185 Products

Required fields are marked with *

0
cart-icon
0
compare icon