Recombinant Human RNF185 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RNF185-5855H |
Product Overview : | RNF185 MS Standard C13 and N15-labeled recombinant protein (NP_001129297) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RNF185 (Ring Finger Protein 185) is a Protein Coding gene. Diseases associated with RNF185 include Cystic Fibrosis and Uremic Neuropathy. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Calnexin/calreticulin cycle. Gene Ontology (GO) annotations related to this gene include ligase activity. An important paralog of this gene is RNF5. |
Molecular Mass : | 14 kDa |
AA Sequence : | MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RNF185 ring finger protein 185 [ Homo sapiens (human) ] |
Official Symbol | RNF185 |
Synonyms | RNF185; ring finger protein 185; E3 ubiquitin-protein ligase RNF185; FLJ38628; hypothetical protein FLJ38628; BSK65-MONO1; BSK65-MONO2; BSK65-PANC1; BSK65-PANC2; BSK65-TEST1; BSK65-TEST2; BSK65-TEST3; |
Gene ID | 91445 |
mRNA Refseq | NM_001135825 |
Protein Refseq | NP_001129297 |
UniProt ID | Q96GF1 |
◆ Recombinant Proteins | ||
RNF185-5078R | Recombinant Rat RNF185 Protein | +Inquiry |
RFL25823PF | Recombinant Full Length Pongo Abelii E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged | +Inquiry |
RNF185-4737R | Recombinant Rat RNF185 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rnf185-5553M | Recombinant Mouse Rnf185 Protein, Myc/DDK-tagged | +Inquiry |
RFL29909DF | Recombinant Full Length Danio Rerio E3 Ubiquitin-Protein Ligase Rnf185(Rnf185) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF185-1523HCL | Recombinant Human RNF185 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF185 Products
Required fields are marked with *
My Review for All RNF185 Products
Required fields are marked with *