Recombinant Human RNF207 Protein, GST-tagged

Cat.No. : RNF207-4355H
Product Overview : Human FLJ46380 full-length ORF ( ENSP00000344316, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNF207 (Ring Finger Protein 207) is a Protein Coding gene. GO annotations related to this gene include ion channel binding and Hsp70 protein binding.
Molecular Mass : 52.4 kDa
AA Sequence : MSGAIFGPLEGPSSLDAPSIHPLVCPLCHVQYERPCLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFLVDSSGDGVEAVRCANCDLECSEQAGAAGRVGEEQRVPGCTVPNACTCTQHVFRGRPGSGFSSTSLGHLGPKCEPHYTGGETEVQNKGLEPVSRQWQRLRPFDLGRAHWSPIQGGVVDLHRRGSPVCRPGPTLKGLCYPSGIEAATAQGRWGQHAVPSGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNF207 ring finger protein 207 [ Homo sapiens ]
Official Symbol RNF207
Synonyms RNF207; ring finger protein 207; C1orf188, chromosome 1 open reading frame 188; RING finger protein 207; FLJ32096; FLJ46380; OTTHUMG00000001089; C1orf188; FLJ46593;
Gene ID 388591
mRNA Refseq NM_207396
Protein Refseq NP_997279
MIM 616923
UniProt ID Q6ZRF8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF207 Products

Required fields are marked with *

My Review for All RNF207 Products

Required fields are marked with *

0
cart-icon