Recombinant Human RNF214 Protein, GST-tagged
Cat.No. : | RNF214-2647H |
Product Overview : | Human DKFZp547C195 partial ORF ( NP_997226, 541 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | RNF214 (Ring Finger Protein 214) is a Protein Coding gene. An important paralog of this gene is TTC3. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LAEHERVAASTQPLGRIRALFPAPLAQISTPMFLPSAQVSYPGRSSHAPATCKLCLMCQKLVQPSELHPMACTHVLHKECIKFWAQTNTNDTCPFCPTLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNF214 ring finger protein 214 [ Homo sapiens ] |
Official Symbol | RNF214 |
Synonyms | RNF214; ring finger protein 214; RING finger protein 214; DKFZp547C195; |
Gene ID | 257160 |
mRNA Refseq | NM_001077239 |
Protein Refseq | NP_001070707 |
UniProt ID | Q8ND24 |
◆ Recombinant Proteins | ||
RNF214-7675M | Recombinant Mouse RNF214 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF214-2647H | Recombinant Human RNF214 Protein, GST-tagged | +Inquiry |
RNF214-14333M | Recombinant Mouse RNF214 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF214-2283HCL | Recombinant Human RNF214 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF214 Products
Required fields are marked with *
My Review for All RNF214 Products
Required fields are marked with *
0
Inquiry Basket