Recombinant Human RNF214 Protein, GST-tagged

Cat.No. : RNF214-2647H
Product Overview : Human DKFZp547C195 partial ORF ( NP_997226, 541 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNF214 (Ring Finger Protein 214) is a Protein Coding gene. An important paralog of this gene is TTC3.
Molecular Mass : 36.74 kDa
AA Sequence : LAEHERVAASTQPLGRIRALFPAPLAQISTPMFLPSAQVSYPGRSSHAPATCKLCLMCQKLVQPSELHPMACTHVLHKECIKFWAQTNTNDTCPFCPTLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNF214 ring finger protein 214 [ Homo sapiens ]
Official Symbol RNF214
Synonyms RNF214; ring finger protein 214; RING finger protein 214; DKFZp547C195;
Gene ID 257160
mRNA Refseq NM_001077239
Protein Refseq NP_001070707
UniProt ID Q8ND24

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF214 Products

Required fields are marked with *

My Review for All RNF214 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon