Recombinant Human RNF219 Protein, GST-tagged

Cat.No. : RNF219-532H
Product Overview : Human C13orf7 partial ORF ( NP_078822, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.19 kDa
AA Sequence : MLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNEDKHLVTDNPSKINPETVAEWKKKLRTANEIYE
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNF219 ring finger protein 219 [ Homo sapiens ]
Official Symbol RNF219
Synonyms RNF219; ring finger protein 219; C13orf7, chromosome 13 open reading frame 7; RING finger protein 219; FLJ13449; C13orf7; FLJ25774; DKFZp686A01276; DKFZp686N15250; DKFZp686O03173;
Gene ID 79596
mRNA Refseq NM_024546
Protein Refseq NP_078822
UniProt ID Q5W0B1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF219 Products

Required fields are marked with *

My Review for All RNF219 Products

Required fields are marked with *

0
cart-icon
0
compare icon