Recombinant Human RNF219 Protein, GST-tagged
Cat.No. : | RNF219-532H |
Product Overview : | Human C13orf7 partial ORF ( NP_078822, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.19 kDa |
AA Sequence : | MLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNEDKHLVTDNPSKINPETVAEWKKKLRTANEIYE |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNF219 ring finger protein 219 [ Homo sapiens ] |
Official Symbol | RNF219 |
Synonyms | RNF219; ring finger protein 219; C13orf7, chromosome 13 open reading frame 7; RING finger protein 219; FLJ13449; C13orf7; FLJ25774; DKFZp686A01276; DKFZp686N15250; DKFZp686O03173; |
Gene ID | 79596 |
mRNA Refseq | NM_024546 |
Protein Refseq | NP_078822 |
UniProt ID | Q5W0B1 |
◆ Recombinant Proteins | ||
RNF219-532H | Recombinant Human RNF219 Protein, GST-tagged | +Inquiry |
RNF219-2620H | Recombinant Human RNF219 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF219 Products
Required fields are marked with *
My Review for All RNF219 Products
Required fields are marked with *