Recombinant Human RNH1
| Cat.No. : | RNH1-30985TH |
| Product Overview : | Recombinant fragment of Human Ribonuclease Inhibitor with a N terminal proprietary tag: predicted molecular weight 35.75 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 92 amino acids |
| Description : | Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases (summarized by Lee et al. |
| Molecular Weight : | 35.750kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ |
| Sequence Similarities : | Contains 15 LRR (leucine-rich) repeats. |
| Gene Name | RNH1 ribonuclease/angiogenin inhibitor 1 [ Homo sapiens ] |
| Official Symbol | RNH1 |
| Synonyms | RNH1; ribonuclease/angiogenin inhibitor 1; ribonuclease/angiogenin inhibitor , RNH; ribonuclease inhibitor; RAI; |
| Gene ID | 6050 |
| mRNA Refseq | NM_002939 |
| Protein Refseq | NP_002930 |
| MIM | 173320 |
| Uniprot ID | P13489 |
| Chromosome Location | 11p15.5 |
| Function | protein binding; ribonuclease inhibitor activity; |
| ◆ Recombinant Proteins | ||
| RNH1-2350H | Recombinant Human RNH1 protein, His-tagged | +Inquiry |
| RNH1-3522H | Recombinant Human RNH1 protein, GST-tagged | +Inquiry |
| RNH1-4521H | Recombinant Human RNH1 protein, His&Myc-tagged | +Inquiry |
| RNH1-1313H | Recombinant Human RNH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RNH1-1900H | Recombinant Human RNH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNH1-2269HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2266HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2265HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2268HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2267HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNH1 Products
Required fields are marked with *
My Review for All RNH1 Products
Required fields are marked with *
