Recombinant Human RNH1

Cat.No. : RNH1-30985TH
Product Overview : Recombinant fragment of Human Ribonuclease Inhibitor with a N terminal proprietary tag: predicted molecular weight 35.75 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 92 amino acids
Description : Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases (summarized by Lee et al.
Molecular Weight : 35.750kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
Sequence Similarities : Contains 15 LRR (leucine-rich) repeats.
Gene Name RNH1 ribonuclease/angiogenin inhibitor 1 [ Homo sapiens ]
Official Symbol RNH1
Synonyms RNH1; ribonuclease/angiogenin inhibitor 1; ribonuclease/angiogenin inhibitor , RNH; ribonuclease inhibitor; RAI;
Gene ID 6050
mRNA Refseq NM_002939
Protein Refseq NP_002930
MIM 173320
Uniprot ID P13489
Chromosome Location 11p15.5
Function protein binding; ribonuclease inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNH1 Products

Required fields are marked with *

My Review for All RNH1 Products

Required fields are marked with *

0
cart-icon
0
compare icon