Recombinant Human RNH1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RNH1-1313H |
| Product Overview : | RNH1 MS Standard C13 and N15-labeled recombinant protein (NP_976320) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases. In addition to control of intracellular RNases, the inhibitor may have a role in the regulation of angiogenin. Ribonuclease inhibitor, of 50,000 Da, binds to ribonucleases and holds them in a latent form. Since neutral and alkaline ribonucleases probably play a critical role in the turnover of RNA in eukaryotic cells, RNH may be essential for control of mRNA turnover; the interaction of eukaryotic cells with ribonuclease may be reversible in vivo. |
| Molecular Mass : | 50 kDa |
| AA Sequence : | Tags(s)X*AWTSRAWTSSVRS*ATLDGPSSSLCSSSAKWSGWTTVASRKHGARTSALHFESTLHWQSSTCAATSWAMSACIACSRACRPPPARSRS*ASRTAA*RGPAAGSCPAHYAPCPPCRSCTSATTSWGMRACSCSAKDSWTPSAAWKSCSWSIAASRLPAASPWPPCSGPSRTSRSSRLATTTSMRLASVCCARA*RTPPASWRRSSWRAAV*HQTTAGTCAALWPPRPRCGSWPWAATSWVMWAWRSCAQGCSTPAPGSGPCGSGSVASLPRAAGICAVSSGPRRA*RSSAWPATSWGMRVPDCCVRPCWNLAASWSRCG*SPAASQPPAAPTSAQCWPRTGFSWSYR*ATTGWRMRACGSCARAWASLALCCGCSGWPTAM*VTAAAAASPQPCWPTTACVSWTSATTAWGTPASCSWWRASGSRAASWSSWSCTTFTGLRRWRTGCRPWRRTSHP*GSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RNH1 ribonuclease/angiogenin inhibitor 1 [ Homo sapiens (human) ] |
| Official Symbol | RNH1 |
| Synonyms | RNH1; ribonuclease/angiogenin inhibitor 1; ribonuclease/angiogenin inhibitor, RNH; ribonuclease inhibitor; RAI; placental RNase inhibitor; placental ribonuclease inhibitor; RNH; MGC4569; MGC18200; MGC54054; |
| Gene ID | 6050 |
| mRNA Refseq | NM_203386 |
| Protein Refseq | NP_976320 |
| MIM | 173320 |
| UniProt ID | P13489 |
| ◆ Recombinant Proteins | ||
| RNH1-2024H | Recombinant Human RNH1 Protein, His&GST-tagged | +Inquiry |
| RNH1-2730H | Recombinant Human RNH1 Protein, His-tagged | +Inquiry |
| Rnh1-6969R | Recombinant Rat Rnh1 protein, His & T7-tagged | +Inquiry |
| RNH1-305H | Recombinant Human RNH1 Protein, MYC/DDK-tagged | +Inquiry |
| RNH1-5540H | Recombinant Human RNH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RNH1-2269HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2266HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2267HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2268HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
| RNH1-2265HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNH1 Products
Required fields are marked with *
My Review for All RNH1 Products
Required fields are marked with *
