Recombinant Human RO60 protein(381-530 aa), C-His-tagged
Cat.No. : | RO60-2625H |
Product Overview : | Recombinant Human RO60 protein(P10155)(381-530 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 381-530 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 18.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVI |
◆ Recombinant Proteins | ||
RO60-5476H | Recombinant Human RO60 Protein (full-length), C-His tagged | +Inquiry |
RO60-2626H | Recombinant Human RO60 protein(381-530 aa), N-MBP & C-His-tagged | +Inquiry |
RO60-17H | Recombinant Human RO60 Protein, N-6×His tagged, Biotinlyated | +Inquiry |
RO60-19H | Recombinant Human RO60 Protein, His tagged | +Inquiry |
RO60-1902H | Recombinant Human RO60 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
RO60-16C | Native Cattle RO60 Protein, Biotinlyated | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RO60 Products
Required fields are marked with *
My Review for All RO60 Products
Required fields are marked with *