Recombinant Human ROGDI Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ROGDI-1374H
Product Overview : ROGDI MS Standard C13 and N15-labeled recombinant protein (NP_078865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein of unknown function. Loss-of-function mutation in this gene cause Kohlschutter-Tonz syndrome. Alternate splicing results in multiple transcript variants.
Molecular Mass : 32.3 kDa
AA Sequence : MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ROGDI rogdi atypical leucine zipper [ Homo sapiens (human) ]
Official Symbol ROGDI
Synonyms ROGDI; rogdi atypical leucine zipper; KTZS; protein rogdi homolog; leucine zipper domain protein; rogdi homolog
Gene ID 79641
mRNA Refseq NM_024589
Protein Refseq NP_078865
MIM 614574
UniProt ID Q9GZN7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ROGDI Products

Required fields are marked with *

My Review for All ROGDI Products

Required fields are marked with *

0
cart-icon