Recombinant Human ROGDI Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ROGDI-1374H |
Product Overview : | ROGDI MS Standard C13 and N15-labeled recombinant protein (NP_078865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein of unknown function. Loss-of-function mutation in this gene cause Kohlschutter-Tonz syndrome. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ROGDI rogdi atypical leucine zipper [ Homo sapiens (human) ] |
Official Symbol | ROGDI |
Synonyms | ROGDI; rogdi atypical leucine zipper; KTZS; protein rogdi homolog; leucine zipper domain protein; rogdi homolog |
Gene ID | 79641 |
mRNA Refseq | NM_024589 |
Protein Refseq | NP_078865 |
MIM | 614574 |
UniProt ID | Q9GZN7 |
◆ Recombinant Proteins | ||
ROGDI-10328Z | Recombinant Zebrafish ROGDI | +Inquiry |
ROGDI-7701M | Recombinant Mouse ROGDI Protein, His (Fc)-Avi-tagged | +Inquiry |
ROGDI-1237H | Recombinant Human ROGDI | +Inquiry |
ROGDI-2356H | Recombinant Human ROGDI, GST-tagged | +Inquiry |
Rogdi-5569M | Recombinant Mouse Rogdi Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROGDI-2254HCL | Recombinant Human ROGDI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROGDI Products
Required fields are marked with *
My Review for All ROGDI Products
Required fields are marked with *