Recombinant Human ROGDI Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ROGDI-1374H |
| Product Overview : | ROGDI MS Standard C13 and N15-labeled recombinant protein (NP_078865) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein of unknown function. Loss-of-function mutation in this gene cause Kohlschutter-Tonz syndrome. Alternate splicing results in multiple transcript variants. |
| Molecular Mass : | 32.3 kDa |
| AA Sequence : | MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ROGDI rogdi atypical leucine zipper [ Homo sapiens (human) ] |
| Official Symbol | ROGDI |
| Synonyms | ROGDI; rogdi atypical leucine zipper; KTZS; protein rogdi homolog; leucine zipper domain protein; rogdi homolog |
| Gene ID | 79641 |
| mRNA Refseq | NM_024589 |
| Protein Refseq | NP_078865 |
| MIM | 614574 |
| UniProt ID | Q9GZN7 |
| ◆ Recombinant Proteins | ||
| ROGDI-2356H | Recombinant Human ROGDI, GST-tagged | +Inquiry |
| ROGDI-7701M | Recombinant Mouse ROGDI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ROGDI-4000H | Recombinant Human ROGDI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ROGDI-2456H | Recombinant Human ROGDI protein, His-tagged | +Inquiry |
| ROGDI-4754R | Recombinant Rat ROGDI Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ROGDI-2254HCL | Recombinant Human ROGDI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROGDI Products
Required fields are marked with *
My Review for All ROGDI Products
Required fields are marked with *
