Recombinant Human ROPN1B Protein (1-120 aa), His-tagged

• Cat.No.: ROPN1B-1507H
• Product Overview: Recombinant Human ROPN1B Protein (1-120 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of isoform 2.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-120 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 15.6 kDa
• AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ROPN1B rhophilin associated tail protein 1B [ Homo sapiens ]
• Official Symbol: ROPN1B
• Synonyms: ROPN1B; rhophilin associated tail protein 1B; ropporin-1B
• Gene ID: 152015
• mRNA Refseq: NM_001012337
• Protein Refseq: NP_001012337
• UniProt ID: Q9BZX4