Recombinant Human ROPN1B Protein (1-120 aa), His-tagged
Cat.No. : | ROPN1B-1507H |
Product Overview : | Recombinant Human ROPN1B Protein (1-120 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-120 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ROPN1B rhophilin associated tail protein 1B [ Homo sapiens ] |
Official Symbol | ROPN1B |
Synonyms | ROPN1B; rhophilin associated tail protein 1B; ropporin-1B; |
Gene ID | 152015 |
mRNA Refseq | NM_001012337 |
Protein Refseq | NP_001012337 |
UniProt ID | Q9BZX4 |
◆ Recombinant Proteins | ||
ROPN1B-1904H | Recombinant Human ROPN1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ROPN1B-781H | Recombinant Human ROPN1B Protein (1-120 aa), GST-tagged | +Inquiry |
ROPN1B-1507H | Recombinant Human ROPN1B Protein (1-120 aa), His-tagged | +Inquiry |
ROPN1B-3955R | Recombinant Rhesus monkey ROPN1B Protein, His-tagged | +Inquiry |
ROPN1B-1920HFL | Recombinant Full Length Human ROPN1B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROPN1B-1533HCL | Recombinant Human ROPN1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROPN1B Products
Required fields are marked with *
My Review for All ROPN1B Products
Required fields are marked with *