"ROR1" Related Products

Expand
Expand

Recombinant Human ROR1 protein, T7/His-tagged

Cat.No.: ROR1-88H
Product Overview: Recombinant human ROR1 extracellular domain cDNA (30-406 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAE LHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFG PPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPS LCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGI PMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFT LDENFKSDLCDIPACDSKDSKEKNKMEILY
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro ROR1 mediated T cell and neuronal cell differentiation regulation study with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction assay.3. Potential biomarker protein for cancer therapy applications.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
Official Symbol: ROR1
Synonyms: ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659;
Gene ID: 4919
mRNA Refseq: NM_001083592
Protein Refseq: NP_001077061
MIM: 602336
UniProt ID: Q01973
Chromosome Location: 1p32-p31
Pathway: Nuclear Receptors, organism-specific biosystem;
Function: ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.