Recombinant Human RPA1 protein, GST-tagged
Cat.No. : | RPA1-31147H |
Product Overview : | Recombinant Human RPA1 protein(317-616 aa), fused with GST tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 317-616 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPA1 replication protein A1, 70kDa [ Homo sapiens ] |
Official Symbol | RPA1 |
Synonyms | RPA1; replication protein A1, 70kDa; replication protein A1 (70kD); replication protein A 70 kDa DNA-binding subunit; HSSB; REPA1; RF A; RP A; RPA70; MSTP075; RP-A p70; RF-A protein 1; replication factor A protein 1; single-stranded DNA-binding protein; RF-A; RP-A; MST075; |
Gene ID | 6117 |
mRNA Refseq | NM_002945 |
Protein Refseq | NP_002936 |
MIM | 179835 |
UniProt ID | P27694 |
◆ Recombinant Proteins | ||
RPA1-1909H | Recombinant Human RPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPA1-685HFL | Recombinant Full Length Human RPA1 Protein, C-Flag-tagged | +Inquiry |
RPA1-31146H | Recombinant Human RPA1, MYC/DDK-tagged | +Inquiry |
Rpa1-2029R | Recombinant Rat Rpa1 Protein, His-tagged | +Inquiry |
RPA1-3849H | Recombinant Human RPA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPA1-2243HCL | Recombinant Human RPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA1 Products
Required fields are marked with *
My Review for All RPA1 Products
Required fields are marked with *