Recombinant Human RPA1 protein, GST-tagged

• Cat.No.: RPA1-31147H
• Product Overview: Recombinant Human RPA1 protein(317-616 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 317-616 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RPA1 replication protein A1, 70kDa [ Homo sapiens ]
• Official Symbol: RPA1
• Synonyms: RPA1; replication protein A1, 70kDa; replication protein A1 (70kD); replication protein A 70 kDa DNA-binding subunit; HSSB; REPA1; RF A; RP A; RPA70; MSTP075; RP-A p70; RF-A protein 1; replication factor A protein 1; single-stranded DNA-binding protein; RF-A; RP-A; MST075
• Gene ID: 6117
• mRNA Refseq: NM_002945
• Protein Refseq: NP_002936
• MIM: 179835
• UniProt ID: P27694