Recombinant Human RPA1 protein, GST-tagged

Cat.No. : RPA1-31147H
Product Overview : Recombinant Human RPA1 protein(317-616 aa), fused with GST tag, was expressed in E.coli.
Availability September 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 317-616 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RPA1 replication protein A1, 70kDa [ Homo sapiens ]
Official Symbol RPA1
Synonyms RPA1; replication protein A1, 70kDa; replication protein A1 (70kD); replication protein A 70 kDa DNA-binding subunit; HSSB; REPA1; RF A; RP A; RPA70; MSTP075; RP-A p70; RF-A protein 1; replication factor A protein 1; single-stranded DNA-binding protein; RF-A; RP-A; MST075;
Gene ID 6117
mRNA Refseq NM_002945
Protein Refseq NP_002936
MIM 179835
UniProt ID P27694

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPA1 Products

Required fields are marked with *

My Review for All RPA1 Products

Required fields are marked with *

0
cart-icon