"RPA2" Related Products

Expand

Recombinant Human RPA2 protein, T7-tagged

Cat.No.: RPA2-176H
Product Overview: Recombinant human RPA2 (270aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSF QNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro DNA replication regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: RPA2 replication protein A2, 32kDa [ Homo sapiens ]
Official Symbol: RPA2
Synonyms: RPA2; replication protein A2, 32kDa; replication protein A2 (32kD); replication protein A 32 kDa subunit; RP-A p32; RP-A p34; RF-A protein 2; replication factor A protein 2; replication protein A 34 kDa subunit; REPA2; RPA32;
Gene ID: 6118
mRNA Refseq: NM_002946
Protein Refseq: NP_002937
MIM: 179836
UniProt ID: P15927
Chromosome Location: 1p35
Pathway: Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the RAD51-ssDNA nucleoprotein complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem;
Function: DNA binding; nucleic acid binding; protein N-terminus binding; protein binding; protein phosphatase binding; single-stranded DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.