Recombinant Human RPA2 protein, T7-tagged

Cat.No. : RPA2-176H
Product Overview : Recombinant human RPA2 (270aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 270 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSF QNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQN QVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro DNA replication regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay development.4. May be used as antigen for specific antibody development and potential cancer diagnostic development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name RPA2 replication protein A2, 32kDa [ Homo sapiens ]
Official Symbol RPA2
Synonyms RPA2; replication protein A2, 32kDa; replication protein A2 (32kD); replication protein A 32 kDa subunit; RP-A p32; RP-A p34; RF-A protein 2; replication factor A protein 2; replication protein A 34 kDa subunit; REPA2; RPA32;
Gene ID 6118
mRNA Refseq NM_002946
Protein Refseq NP_002937
MIM 179836
UniProt ID P15927
Chromosome Location 1p35
Pathway Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the RAD51-ssDNA nucleoprotein complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem;
Function DNA binding; nucleic acid binding; protein N-terminus binding; protein binding; protein phosphatase binding; single-stranded DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPA2 Products

Required fields are marked with *

My Review for All RPA2 Products

Required fields are marked with *

0
cart-icon