Recombinant Human RPA3 Protein, GST-tagged

• Cat.No.: RPA3-1039H
• Product Overview: Human RPA3 full-length ORF ( NP_002938.1, 1 a.a. - 121 a.a.) recombinant protein was expressed in wheat germ with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 40 kDa
• AA Sequence: MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RPA3 replication protein A3 [ Homo sapiens (human) ]
• Official Symbol: RPA3
• Synonyms: REPA3; RP-A p14
• Gene ID: 6119
• mRNA Refseq: NM_002947.3
• Protein Refseq: NP_002938.1
• MIM: 179837
• UniProt ID: P35244