Recombinant Human RPA3 Protein, GST-tagged
| Cat.No. : | RPA3-1039H |
| Product Overview : | Human RPA3 full-length ORF ( NP_002938.1, 1 a.a. - 121 a.a.) recombinant protein was expressed in wheat germ with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 40 kDa |
| AA Sequence : | MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | RPA3 replication protein A3 [ Homo sapiens (human) ] |
| Official Symbol | RPA3 |
| Synonyms | REPA3; RP-A p14 |
| Gene ID | 6119 |
| mRNA Refseq | NM_002947.3 |
| Protein Refseq | NP_002938.1 |
| MIM | 179837 |
| UniProt ID | P35244 |
| ◆ Recombinant Proteins | ||
| RPA3-1530HF | Recombinant Full Length Human RPA3 Protein, GST-tagged | +Inquiry |
| RPA3-10567Z | Recombinant Zebrafish RPA3 | +Inquiry |
| RPA3-7711M | Recombinant Mouse RPA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPA3-3777R | Recombinant Rhesus Macaque RPA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPA3-14388M | Recombinant Mouse RPA3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPA3-2241HCL | Recombinant Human RPA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA3 Products
Required fields are marked with *
My Review for All RPA3 Products
Required fields are marked with *
