Recombinant Human RPA3 Protein, GST-tagged

Cat.No. : RPA3-1039H
Product Overview : Human RPA3 full-length ORF ( NP_002938.1, 1 a.a. - 121 a.a.) recombinant protein was expressed in wheat germ with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 40 kDa
AA Sequence : MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name RPA3 replication protein A3 [ Homo sapiens (human) ]
Official Symbol RPA3
Synonyms REPA3; RP-A p14
Gene ID 6119
mRNA Refseq NM_002947.3
Protein Refseq NP_002938.1
MIM 179837
UniProt ID P35244

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPA3 Products

Required fields are marked with *

My Review for All RPA3 Products

Required fields are marked with *

0
cart-icon
0
compare icon