Recombinant Human RPA3 protein, GST-tagged
Cat.No. : | RPA3-3442H |
Product Overview : | Recombinant Human RPA3 protein(P35244)(1-119aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-119aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RPA3 replication protein A3, 14kDa [ Homo sapiens ] |
Official Symbol | RPA3 |
Synonyms | RPA3; replication protein A3, 14kDa; replication protein A3 (14kD); replication protein A 14 kDa subunit; REPA3; RP-A p14; RF-A protein 3; replication factor A protein 3; |
Gene ID | 6119 |
mRNA Refseq | NM_002947 |
Protein Refseq | NP_002938 |
MIM | 179837 |
UniProt ID | P35244 |
◆ Recombinant Proteins | ||
RPA3-1039H | Recombinant Human RPA3 Protein, GST-tagged | +Inquiry |
RPA3-1530HF | Recombinant Full Length Human RPA3 Protein, GST-tagged | +Inquiry |
RPA3-3441H | Recombinant Human RPA3 protein, His-tagged | +Inquiry |
RPA3-3442H | Recombinant Human RPA3 protein, GST-tagged | +Inquiry |
RPA3-3960R | Recombinant Rhesus monkey RPA3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPA3-2241HCL | Recombinant Human RPA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA3 Products
Required fields are marked with *
My Review for All RPA3 Products
Required fields are marked with *
0
Inquiry Basket