Recombinant Human RPAP1 protein, His-tagged
Cat.No. : | RPAP1-3831H |
Product Overview : | Recombinant Human RPAP1 protein(1-351 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-351 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLDNLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFASEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPAP1 RNA polymerase II associated protein 1 [ Homo sapiens ] |
Official Symbol | RPAP1 |
Synonyms | RPAP1; RNA polymerase II associated protein 1; RNA polymerase II-associated protein 1; DKFZP727M111; FLJ12732; KIAA1403; MGC858; DKFZp727M111; |
Gene ID | 26015 |
mRNA Refseq | NM_015540 |
Protein Refseq | NP_056355 |
MIM | 611475 |
UniProt ID | Q9BWH6 |
◆ Recombinant Proteins | ||
RPAP1-3831H | Recombinant Human RPAP1 protein, His-tagged | +Inquiry |
RPAP1-2368H | Recombinant Human RPAP1, GST-tagged | +Inquiry |
RPAP1-4760R | Recombinant Rat RPAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPAP1-7712M | Recombinant Mouse RPAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPAP1-5101R | Recombinant Rat RPAP1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPAP1 Products
Required fields are marked with *
My Review for All RPAP1 Products
Required fields are marked with *
0
Inquiry Basket