Recombinant Human RPF2 protein, His-tagged
Cat.No. : | RPF2-2455H |
Product Overview : | Recombinant Human RPF2 protein(1-297 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-297 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RPF2 ribosome production factor 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RPF2 |
Synonyms | RPF2; ribosome production factor 2 homolog (S. cerevisiae); brix domain containing 1 , BXDC1; ribosome production factor 2 homolog; bA397G5.4; FLJ21087; ribosomal processing factor 2 homolog (S. cerevisiae); homolog of Rpf2; brix domain containing 1; brix domain-containing protein 1; ribosomal processing factor 2 homolog; ribosome biogenesis protein RPF2 homolog; BXDC1 |
Gene ID | 84154 |
mRNA Refseq | NM_032194 |
Protein Refseq | NP_115570 |
UniProt ID | Q9H7B2 |
◆ Recombinant Proteins | ||
RPF2-3783R | Recombinant Rhesus Macaque RPF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPF2-3966R | Recombinant Rhesus monkey RPF2 Protein, His-tagged | +Inquiry |
RPF2-406H | Recombinant Human RPF2 Protein, GST-tagged | +Inquiry |
RPF2-2455H | Recombinant Human RPF2 protein, His-tagged | +Inquiry |
RPF2-12770Z | Recombinant Zebrafish RPF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPF2-2235HCL | Recombinant Human RPF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPF2 Products
Required fields are marked with *
My Review for All RPF2 Products
Required fields are marked with *