Recombinant Human RPL35 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RPL35-3598H |
| Product Overview : | RPL35 MS Standard C13 and N15-labeled recombinant protein (NP_009140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Molecular Mass : | 14.6 kDa |
| AA Sequence : | MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVRATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RPL35 ribosomal protein L35 [ Homo sapiens (human) ] |
| Official Symbol | RPL35 |
| Synonyms | RPL35; ribosomal protein L35; L35; DBA19; 60S ribosomal protein L35; large ribosomal subunit protein uL29 |
| Gene ID | 11224 |
| mRNA Refseq | NM_007209 |
| Protein Refseq | NP_009140 |
| MIM | 618315 |
| UniProt ID | P42766 |
| ◆ Recombinant Proteins | ||
| RPL35-14433M | Recombinant Mouse RPL35 Protein | +Inquiry |
| RPL35-7742M | Recombinant Mouse RPL35 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPL35-29H | Recombinant Human RPL35 protein, MYC/DDK-tagged | +Inquiry |
| RPL35-5126R | Recombinant Rat RPL35 Protein | +Inquiry |
| Rpl35-5591M | Recombinant Mouse Rpl35 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPL35-2201HCL | Recombinant Human RPL35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPL35 Products
Required fields are marked with *
My Review for All RPL35 Products
Required fields are marked with *
