Recombinant Human RPL35 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RPL35-3598H
Product Overview : RPL35 MS Standard C13 and N15-labeled recombinant protein (NP_009140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Mass : 14.6 kDa
AA Sequence : MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVRATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RPL35 ribosomal protein L35 [ Homo sapiens (human) ]
Official Symbol RPL35
Synonyms RPL35; ribosomal protein L35; L35; DBA19; 60S ribosomal protein L35; large ribosomal subunit protein uL29
Gene ID 11224
mRNA Refseq NM_007209
Protein Refseq NP_009140
MIM 618315
UniProt ID P42766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL35 Products

Required fields are marked with *

My Review for All RPL35 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon