Recombinant Human RPLP2
Cat.No. : | RPLP2-29464TH |
Product Overview : | Recombinant Full Length Human RPLP2 produced in Saccharomyces cerevisiae; amino acids 1-115; , 11.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-115 a.a. |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLN KVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSA APAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD |
Sequence Similarities : | Belongs to the ribosomal protein L12P family. |
Full Length : | Full L. |
Gene Name | RPLP2 ribosomal protein, large, P2 [ Homo sapiens ] |
Official Symbol | RPLP2 |
Synonyms | RPLP2; ribosomal protein, large, P2; D11S2243E; 60S acidic ribosomal protein P2; acidic ribosomal phosphoprotein P2; LP2; MGC71408; P2; RPP2; |
Gene ID | 6181 |
mRNA Refseq | NM_001004 |
Protein Refseq | NP_000995 |
MIM | 180530 |
Uniprot ID | P05387 |
Chromosome Location | 11p15.5 |
Pathway | Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem; |
Function | RNA binding; structural constituent of ribosome; |
◆ Recombinant Proteins | ||
RPLP2-5141R | Recombinant Rat RPLP2 Protein | +Inquiry |
RPLP2-12014Z | Recombinant Zebrafish RPLP2 | +Inquiry |
RPLP2-29464TH | Recombinant Human RPLP2 | +Inquiry |
RPLP2-7758M | Recombinant Mouse RPLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPLP2-5550H | Recombinant Human Ribosomal Protein, Large, P2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPLP2-1541HCL | Recombinant Human RPLP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPLP2 Products
Required fields are marked with *
My Review for All RPLP2 Products
Required fields are marked with *