Recombinant Human RPLP2 protein, His-tagged

Cat.No. : RPLP2-3448H
Product Overview : Recombinant Human RPLP2 protein(P05387)(1-115aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-115aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 15.7 kDa
AA Sequence : MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name RPLP2 ribosomal protein, large, P2 [ Homo sapiens ]
Official Symbol RPLP2
Synonyms RPLP2; ribosomal protein, large, P2; D11S2243E; 60S acidic ribosomal protein P2; acidic ribosomal phosphoprotein P2; LP2; MGC71408; P2; RPP2; renal carcinoma antigen NY-REN-44;
Gene ID 6181
mRNA Refseq NM_001004
Protein Refseq NP_000995
MIM 180530
UniProt ID P05387

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPLP2 Products

Required fields are marked with *

My Review for All RPLP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon