Recombinant Human RPLP2 protein, His-tagged
Cat.No. : | RPLP2-3448H |
Product Overview : | Recombinant Human RPLP2 protein(P05387)(1-115aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-115aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.7 kDa |
AA Sequence : | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RPLP2 ribosomal protein, large, P2 [ Homo sapiens ] |
Official Symbol | RPLP2 |
Synonyms | RPLP2; ribosomal protein, large, P2; D11S2243E; 60S acidic ribosomal protein P2; acidic ribosomal phosphoprotein P2; LP2; MGC71408; P2; RPP2; renal carcinoma antigen NY-REN-44; |
Gene ID | 6181 |
mRNA Refseq | NM_001004 |
Protein Refseq | NP_000995 |
MIM | 180530 |
UniProt ID | P05387 |
◆ Recombinant Proteins | ||
RPLP2-5141R | Recombinant Rat RPLP2 Protein | +Inquiry |
RPLP2-5550H | Recombinant Human Ribosomal Protein, Large, P2, His-tagged | +Inquiry |
RPLP2-4800R | Recombinant Rat RPLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPLP2-3111H | Recombinant Human RPLP2 protein, His-tagged | +Inquiry |
RPLP2-7758M | Recombinant Mouse RPLP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPLP2-1541HCL | Recombinant Human RPLP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPLP2 Products
Required fields are marked with *
My Review for All RPLP2 Products
Required fields are marked with *