Recombinant Human RPS20 protein(11-90 aa), C-His-tagged
| Cat.No. : | RPS20-2797H |
| Product Overview : | Recombinant Human RPS20 protein(P60866)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-90 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLID |
| Gene Name | RPS20 ribosomal protein S20 [ Homo sapiens ] |
| Official Symbol | RPS20 |
| Synonyms | RPS20; ribosomal protein S20; 40S ribosomal protein S20; S20; FLJ27451; MGC102930; |
| Gene ID | 6224 |
| mRNA Refseq | NM_001023 |
| Protein Refseq | NP_001014 |
| MIM | 603682 |
| UniProt ID | P60866 |
| ◆ Recombinant Proteins | ||
| RPS20-12412Z | Recombinant Zebrafish RPS20 | +Inquiry |
| Rps20-5604M | Recombinant Mouse Rps20 Protein, Myc/DDK-tagged | +Inquiry |
| RPS20-5158R | Recombinant Rat RPS20 Protein | +Inquiry |
| RPS20-4017R | Recombinant Rhesus monkey RPS20 Protein, His-tagged | +Inquiry |
| RPS20-7778M | Recombinant Mouse RPS20 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPS20-561HCL | Recombinant Human RPS20 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS20 Products
Required fields are marked with *
My Review for All RPS20 Products
Required fields are marked with *


