Recombinant Human RPS20 protein(11-90 aa), C-His-tagged

Cat.No. : RPS20-2797H
Product Overview : Recombinant Human RPS20 protein(P60866)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-90 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLID
Gene Name RPS20 ribosomal protein S20 [ Homo sapiens ]
Official Symbol RPS20
Synonyms RPS20; ribosomal protein S20; 40S ribosomal protein S20; S20; FLJ27451; MGC102930;
Gene ID 6224
mRNA Refseq NM_001023
Protein Refseq NP_001014
MIM 603682
UniProt ID P60866

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS20 Products

Required fields are marked with *

My Review for All RPS20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon