Recombinant Human RPS2P32 Protein, GST-tagged

Cat.No. : RPS2P32-4333H
Product Overview : Human MGC27348 full-length ORF ( AAH26177.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RPS2P32 (Ribosomal Protein S2 Pseudogene 32) is a Pseudogene.
Molecular Mass : 46.1 kDa
AA Sequence : MKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDYNGYAGRVEVLQGGGRRHPRGHHPDQALHCHRAQRLLGEQDRQAPHRPLQGDRPLRLCAGALHPRAQGHWHRLSSCAQEAAHDSWYLRLLHLSQGLHCHPGQLRQRHLGCCL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RPS2P32 ribosomal protein S2 pseudogene 32 [ Homo sapiens (human) ]
Official Symbol RPS2P32
Synonyms RPS2P32; ribosomal protein S2 pseudogene 32; RPS2_14_794;
Gene ID 256355

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS2P32 Products

Required fields are marked with *

My Review for All RPS2P32 Products

Required fields are marked with *

0
cart-icon
0
compare icon