Recombinant Human RPS2P32 Protein, GST-tagged
| Cat.No. : | RPS2P32-4333H |
| Product Overview : | Human MGC27348 full-length ORF ( AAH26177.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | RPS2P32 (Ribosomal Protein S2 Pseudogene 32) is a Pseudogene. |
| Molecular Mass : | 46.1 kDa |
| AA Sequence : | MKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDYNGYAGRVEVLQGGGRRHPRGHHPDQALHCHRAQRLLGEQDRQAPHRPLQGDRPLRLCAGALHPRAQGHWHRLSSCAQEAAHDSWYLRLLHLSQGLHCHPGQLRQRHLGCCL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RPS2P32 ribosomal protein S2 pseudogene 32 [ Homo sapiens (human) ] |
| Official Symbol | RPS2P32 |
| Synonyms | RPS2P32; ribosomal protein S2 pseudogene 32; RPS2_14_794; |
| Gene ID | 256355 |
| ◆ Recombinant Proteins | ||
| RPS2P32-6173HF | Recombinant Full Length Human RPS2P32 Protein, GST-tagged | +Inquiry |
| RPS2P32-4333H | Recombinant Human RPS2P32 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPS2P32 Products
Required fields are marked with *
My Review for All RPS2P32 Products
Required fields are marked with *
