Recombinant Human RPSA
| Cat.No. : | RPSA-26030TH |
| Product Overview : | Recombinant fragment ofHuman 67kDa Laminin Receptor with a proprietary tag; 100 amino acids plus the tag. predicted MWt 36.63 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced. |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS |
| Sequence Similarities : | Belongs to the ribosomal protein S2P family. |
| Gene Name | RPSA ribosomal protein SA [ Homo sapiens ] |
| Official Symbol | RPSA |
| Synonyms | RPSA; ribosomal protein SA; laminin receptor 1 (67kD, ribosomal protein SA) , LAMR1; 40S ribosomal protein SA; 37LRP; LRP; p40; SA; |
| Gene ID | 3921 |
| mRNA Refseq | NM_001012321 |
| Protein Refseq | NP_001012321 |
| MIM | 150370 |
| Uniprot ID | P08865 |
| Chromosome Location | 3p21.3 |
| Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
| Function | protein binding; receptor activity; ribosome binding; structural constituent of ribosome; |
| ◆ Recombinant Proteins | ||
| rpsA-4639H | Recombinant Escherichia coli (strain K12) rpsA protein, His-tagged | +Inquiry |
| RPSA-2595H | Recombinant Human RPSA Protein (2-295 aa), His-Myc-tagged | +Inquiry |
| RPSA-3512H | Recombinant Human RPSA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RPSA-14506M | Recombinant Mouse RPSA Protein | +Inquiry |
| Rpsa-1293M | Recombinant Mouse Rpsa Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPSA-2154HCL | Recombinant Human RPSA 293 Cell Lysate | +Inquiry |
| RPSA-2155HCL | Recombinant Human RPSA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPSA Products
Required fields are marked with *
My Review for All RPSA Products
Required fields are marked with *
