Recombinant Human RPTOR
Cat.No. : | RPTOR-30506TH |
Product Overview : | Recombinant full length Human Raptor with proprietary tag; Predicted MWt 67.76 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 379 amino acids |
Description : | This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 67.760kDa inclusive of tags |
Tissue specificity : | Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW |
Sequence Similarities : | Belongs to the WD repeat RAPTOR family.Contains 7 WD repeats. |
Gene Name | RPTOR regulatory associated protein of MTOR, complex 1 [ Homo sapiens ] |
Official Symbol | RPTOR |
Synonyms | RPTOR; regulatory associated protein of MTOR, complex 1; regulatory-associated protein of mTOR; KIAA1303; KOG1; Mip1; raptor; regulatory associated protein of mTOR; |
Gene ID | 57521 |
mRNA Refseq | NM_001163034 |
Protein Refseq | NP_001156506 |
MIM | 607130 |
Uniprot ID | Q8N122 |
Chromosome Location | 17q25.3 |
Pathway | AMPK signaling, organism-specific biosystem; Energy dependent regulation of mTOR by LKB1-AMPK, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem; IRS-related events, organism-specific biosystem; Insulin receptor signalling cascade, organism-specific biosystem; |
Function | 14-3-3 protein binding; RNA polymerase III type 1 promoter DNA binding; RNA polymerase III type 2 promoter DNA binding; RNA polymerase III type 3 promoter DNA binding; TFIIIC-class transcription factor binding; |
◆ Recombinant Proteins | ||
RPTOR-30506TH | Recombinant Human RPTOR | +Inquiry |
RPTOR-448HF | Recombinant Full Length Human RPTOR Protein | +Inquiry |
RPTOR-2666H | Recombinant Human RPTOR Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPTOR-1543HCL | Recombinant Human RPTOR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPTOR Products
Required fields are marked with *
My Review for All RPTOR Products
Required fields are marked with *