Recombinant Human RPTOR

Cat.No. : RPTOR-30506TH
Product Overview : Recombinant full length Human Raptor with proprietary tag; Predicted MWt 67.76 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 379 amino acids
Description : This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 67.760kDa inclusive of tags
Tissue specificity : Highly expressed in skeletal muscle, and in a lesser extent in brain, lung, small intestine, kidney and placenta.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW
Sequence Similarities : Belongs to the WD repeat RAPTOR family.Contains 7 WD repeats.
Gene Name RPTOR regulatory associated protein of MTOR, complex 1 [ Homo sapiens ]
Official Symbol RPTOR
Synonyms RPTOR; regulatory associated protein of MTOR, complex 1; regulatory-associated protein of mTOR; KIAA1303; KOG1; Mip1; raptor; regulatory associated protein of mTOR;
Gene ID 57521
mRNA Refseq NM_001163034
Protein Refseq NP_001156506
MIM 607130
Uniprot ID Q8N122
Chromosome Location 17q25.3
Pathway AMPK signaling, organism-specific biosystem; Energy dependent regulation of mTOR by LKB1-AMPK, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem; IRS-related events, organism-specific biosystem; Insulin receptor signalling cascade, organism-specific biosystem;
Function 14-3-3 protein binding; RNA polymerase III type 1 promoter DNA binding; RNA polymerase III type 2 promoter DNA binding; RNA polymerase III type 3 promoter DNA binding; TFIIIC-class transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPTOR Products

Required fields are marked with *

My Review for All RPTOR Products

Required fields are marked with *

0
cart-icon