Recombinant Human RREB1 protein, GST-tagged

Cat.No. : RREB1-301517H
Product Overview : Recombinant Human RREB1 (1324-1514 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1324-Cys1514
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MREEHGRGESHEPEEEHGTEESTGDADGAEEDASSNQSLDLDFATKLMDFKLAEGDGEAGAGGAASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQEPKDEKGDGASTAEEGPQPAPEQEEKPPETPAEVVESAPGAGEAPAEKLAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSPKSVASKADKRKKVC
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name RREB1 ras responsive element binding protein 1 [ Homo sapiens ]
Official Symbol RREB1
Synonyms RREB1; ras responsive element binding protein 1; ras-responsive element-binding protein 1; hindsight homolog (drosophila); HNT; hindsight homolog; DNA-binding protein; finger protein in nuclear bodies; raf-responsive zinc finger protein LZ321; zinc finger motif enhancer binding protein 1; zinc finger motif enhancer-binding protein 1; zinc finger motif-enhancer binding-protein 1; FINB; LZ321; Zep-1; RREB-1;
Gene ID 6239
mRNA Refseq NM_001003698
Protein Refseq NP_001003698
MIM 602209
UniProt ID Q92766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RREB1 Products

Required fields are marked with *

My Review for All RREB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon