Recombinant Human RREB1 protein, GST-tagged

• Cat.No.: RREB1-301517H
• Product Overview: Recombinant Human RREB1 (1324-1514 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1324-Cys1514
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MREEHGRGESHEPEEEHGTEESTGDADGAEEDASSNQSLDLDFATKLMDFKLAEGDGEAGAGGAASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQEPKDEKGDGASTAEEGPQPAPEQEEKPPETPAEVVESAPGAGEAPAEKLAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSPKSVASKADKRKKVC
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RREB1 ras responsive element binding protein 1 [ Homo sapiens ]
• Official Symbol: RREB1
• Synonyms: RREB1; ras responsive element binding protein 1; ras-responsive element-binding protein 1; hindsight homolog (drosophila); HNT; hindsight homolog; DNA-binding protein; finger protein in nuclear bodies; raf-responsive zinc finger protein LZ321; zinc finger motif enhancer binding protein 1; zinc finger motif enhancer-binding protein 1; zinc finger motif-enhancer binding-protein 1; FINB; LZ321; Zep-1; RREB-1
• Gene ID: 6239
• mRNA Refseq: NM_001003698
• Protein Refseq: NP_001003698
• MIM: 602209
• UniProt ID: Q92766