Recombinant Human RREB1 protein, GST-tagged
Cat.No. : | RREB1-301517H |
Product Overview : | Recombinant Human RREB1 (1324-1514 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1324-Cys1514 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MREEHGRGESHEPEEEHGTEESTGDADGAEEDASSNQSLDLDFATKLMDFKLAEGDGEAGAGGAASQEQKLACDTCGKSFKFLGTLSRHRKAHGRQEPKDEKGDGASTAEEGPQPAPEQEEKPPETPAEVVESAPGAGEAPAEKLAEETEGPSDGESAAEKRSSEKSDDDKKPKTDSPKSVASKADKRKKVC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RREB1 ras responsive element binding protein 1 [ Homo sapiens ] |
Official Symbol | RREB1 |
Synonyms | RREB1; ras responsive element binding protein 1; ras-responsive element-binding protein 1; hindsight homolog (drosophila); HNT; hindsight homolog; DNA-binding protein; finger protein in nuclear bodies; raf-responsive zinc finger protein LZ321; zinc finger motif enhancer binding protein 1; zinc finger motif enhancer-binding protein 1; zinc finger motif-enhancer binding-protein 1; FINB; LZ321; Zep-1; RREB-1; |
Gene ID | 6239 |
mRNA Refseq | NM_001003698 |
Protein Refseq | NP_001003698 |
MIM | 602209 |
UniProt ID | Q92766 |
◆ Recombinant Proteins | ||
RREB1-7811M | Recombinant Mouse RREB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RREB1-6606C | Recombinant Chicken RREB1 | +Inquiry |
RREB1-301517H | Recombinant Human RREB1 protein, GST-tagged | +Inquiry |
RREB1-14522M | Recombinant Mouse RREB1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RREB1 Products
Required fields are marked with *
My Review for All RREB1 Products
Required fields are marked with *