Recombinant Human RS1 protein, GST-tagged
| Cat.No. : | RS1-3453H |
| Product Overview : | Recombinant Human RS1 protein(O15537)(24-224aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-224aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50 kDa |
| AA Sequence : | STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| RS1-561HFL | Recombinant Full Length Human RS1 Protein, C-Flag-tagged | +Inquiry |
| RS1-4040R | Recombinant Rhesus monkey RS1 Protein, His-tagged | +Inquiry |
| RS1-3452H | Recombinant Human RS1 protein, His-tagged | +Inquiry |
| RS1-1923H | Recombinant Human RS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Rs1-5631M | Recombinant Mouse Rs1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RS1-2137HCL | Recombinant Human RS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RS1 Products
Required fields are marked with *
My Review for All RS1 Products
Required fields are marked with *



