Recombinant Human RSPO1 protein(31-263aa), His-Avi-tagged
| Cat.No. : | RSPO1-7532H |
| Product Overview : | Recombinant Human RSPO1 protein(Q2MKA7)(31-263aa), fused with C-terminal His and Avi tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Avi&His |
| Protein Length : | 31-263aa |
| Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5, the EC50 is 124.0-174.1 ng/mL. |
| Molecular Mass : | 30.2 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
| Gene Name | RSPO1 R-spondin 1 [ Homo sapiens ] |
| Official Symbol | RSPO1 |
| Synonyms | RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1; |
| Gene ID | 284654 |
| mRNA Refseq | NM_001038633 |
| Protein Refseq | NP_001033722 |
| MIM | 609595 |
| UniProt ID | Q2MKA7 |
| ◆ Recombinant Proteins | ||
| RSPO1-4342H | Recombinant Human RSPO1 protein, GMP Grade, Animal-Free, For Organoid Culture | +Inquiry |
| RSPO1-1029H | Active Recombinant Human RSPO1 protein, His-tagged | +Inquiry |
| RSPO1-2612H | Active Recombinant Human RSPO1 Protein, His-tagged | +Inquiry |
| Rspo1-4024M | Recombinant Mouse Rspo1, His tagged | +Inquiry |
| RSPO1-132H | Active Recombinant Human RSPO1 Protein (Ser21-Ala263), N-His-SUMO tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RSPO1-1918HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
| RSPO1-001HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
| RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPO1 Products
Required fields are marked with *
My Review for All RSPO1 Products
Required fields are marked with *
